(data stored in ACNUC7421 zone)

EMBL: CP000675.SDHB

CP000675.SDHB        Location/Qualifiers
FT   CDS             complement(166083..171680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="LPC_0156"
FT                   /product="SdhB protein, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54155"
FT                   /protein_id="ABQ54155.1"
FT                   /translation="MPDKKSSETLLSQQINEVRGLLLQALKTQLDDLVAEKLIPQPSGV
FT                   PFVDFEKDPPQIATLKKVINCLYHAEEAFKSWESIDTSTLLGKAKAAPKLIHALTQIYK
FT                   SLGLLDEASPEIRSVIADNYHLLEPLFTQAYAIVQESGWLSEFMEMDVTDKASKVIFQG
FT                   MDLLGPDVDKWHDTHPLVDAFSKISKLVETISTLQEKDMPGKEKEQAVELIRALLDDLD
FT                   NNPFISKLSISDFEDSKAIKDLLEWFKNIQDDGFDFSKKSIKQYVSWANHYLPTLIAFA
FT                   DQLERQNYLKPGSLSANLCSQIEHLGKQVNDILSEPGFGVTERVVTIDSLQGQREQKIH
FT                   NAQVKSVQVIMATEKQLAATADFYQILEAYKGMNLSQITEPDRRVLRQLYPQIQTALAH
FT                   ASLDLENQLTSVLNTTGPEKTPAKPKSWWELAKDGLGYVASYVVNYNVDKILGTRESVD
FT                   RFLSSQIASEQFKILIAEKAREKLRTGSDKIKETALQYQAEARLNAIKSTLRKQPSQME
FT                   APPSEFVAVKPSKLVNLRGTLTAIQEMQLSTTVNGTRTSVDTLIHRHLPEKYQACFSTL
FT                   PYQINENDPELVKKIKTVENNLFQLEKALKDFEKIDLSYGIMIRLHYFIAIASAASKLK
FT                   SSVKELPPEGQKALAPLLQQIMTLGLSFSDTNYTANDLSALQQLKMEGEVRPKSPSVAS
FT                   PDTIGTLPEETGKRTVKKPKEKTTELLDYADKISNARASLLNKFKNTLSPALADSLNPQ
FT                   KNGVPFVHLDQDPPQIAAIKKIINSMYHAECALKTWHGIDTSTTLGKVAAAHQGVAALS
FT                   QVYKSFTLFTEDFSDIHNLIRENHDLIAPVIIEANKLVNQYGWARQFSELDIAQQLGSI
FT                   LGQGINTVQPKTDEITQTASLVKLFSEIPRLLNNISSSLDQKSEKSIDELKISNKKIEA
FT                   IGAVFELFFEENAHLMSMFKGFSAISGLIELNKKIQLEGTNLQEVTIRQYQSWLKEGYP
FT                   NLMMILDEIETRHYLTPGFLSAPIALELDQINDKLNEIIETKPDFKLQKIPLSFYMGDK
FT                   RIERLMTKKTEHCLAVLQIEEQKKAVNTFFGILKHYSDQPLSNIKPNELAQLRLAFVEI
FT                   QSAMANSNLELSNDFVAALNQLETSPPEKTKKIQVTVSQLLKVQPAVETYLNEHKKSSE
FT                   LKIAVIDKAIEHVKDKSFELKSGASKEINIPQLRKTFLETESKKPVVGPGELKPTSVSS
FT                   LNTVRGNLAYIQELKISSTVGMMREQFSALTRDNFSNRVQKYLIKPQDKPLHMINDNDP
FT                   LMVRQIKEVENGLYHLETALKQFEQMKKSDSLVSQTKALLEIANHALQLKMAVERFSPE
FT                   LKEHYGPLVRTVLSFSNKIQSINYNKEDWADLQFILNRAHKELLKRKTPRDHRIEKAFF
FT                   EAGVREVQIDRDESVGKKAAKLGVKYAHLASPQLEKARAYLSSRYKNAFGQQPKVIRSF
FT                   TREQLANEEFMDAEISRLKETLEEKYGFNIATIKVLLDLLEQIQRAGAQAAEVAGMVNT
FT                   LVTYDFPKIKENAYRDLLTKLSQEEDYLNLKPGTLINPAMAAVNQLFLSAALELDMPFS
FT                   KKLSILDDTTYVNILIRQTESDLQTLKEKLSEDPSNHEIAFEIEIKNDKLAFLRQQMVL
FT                   LEDKNPNQTRNVLMDMQFEVSLRNHLVYTTLKAPIAQEYEQIAIEYYKKNKNRFLYADD
FT                   CSKELLQGLKEFEKKHLPDHLIVFEAYDRLRLFSAKLPPKNQDVKEYIENINRELQNRD
FT                   IPIRQRALKVKLLPNDTVFIEKLISADKGTHFLRKFMQFITIITASITEAIKTGGSLVY
FT                   IYRQKQMEQSIKNIEKSISFKEELHTIKDPDGPSPRKEEGQEGEIEFTKL"
     MPDKKSSETL LSQQINEVRG LLLQALKTQL DDLVAEKLIP QPSGVPFVDF EKDPPQIATL        60
     KKVINCLYHA EEAFKSWESI DTSTLLGKAK AAPKLIHALT QIYKSLGLLD EASPEIRSVI       120
     ADNYHLLEPL FTQAYAIVQE SGWLSEFMEM DVTDKASKVI FQGMDLLGPD VDKWHDTHPL       180
     VDAFSKISKL VETISTLQEK DMPGKEKEQA VELIRALLDD LDNNPFISKL SISDFEDSKA       240
     IKDLLEWFKN IQDDGFDFSK KSIKQYVSWA NHYLPTLIAF ADQLERQNYL KPGSLSANLC       300
     SQIEHLGKQV NDILSEPGFG VTERVVTIDS LQGQREQKIH NAQVKSVQVI MATEKQLAAT       360
     ADFYQILEAY KGMNLSQITE PDRRVLRQLY PQIQTALAHA SLDLENQLTS VLNTTGPEKT       420
     PAKPKSWWEL AKDGLGYVAS YVVNYNVDKI LGTRESVDRF LSSQIASEQF KILIAEKARE       480
     KLRTGSDKIK ETALQYQAEA RLNAIKSTLR KQPSQMEAPP SEFVAVKPSK LVNLRGTLTA       540
     IQEMQLSTTV NGTRTSVDTL IHRHLPEKYQ ACFSTLPYQI NENDPELVKK IKTVENNLFQ       600
     LEKALKDFEK IDLSYGIMIR LHYFIAIASA ASKLKSSVKE LPPEGQKALA PLLQQIMTLG       660
     LSFSDTNYTA NDLSALQQLK MEGEVRPKSP SVASPDTIGT LPEETGKRTV KKPKEKTTEL       720
     LDYADKISNA RASLLNKFKN TLSPALADSL NPQKNGVPFV HLDQDPPQIA AIKKIINSMY       780
     HAECALKTWH GIDTSTTLGK VAAAHQGVAA LSQVYKSFTL FTEDFSDIHN LIRENHDLIA       840
     PVIIEANKLV NQYGWARQFS ELDIAQQLGS ILGQGINTVQ PKTDEITQTA SLVKLFSEIP       900
     RLLNNISSSL DQKSEKSIDE LKISNKKIEA IGAVFELFFE ENAHLMSMFK GFSAISGLIE       960
     LNKKIQLEGT NLQEVTIRQY QSWLKEGYPN LMMILDEIET RHYLTPGFLS APIALELDQI      1020
     NDKLNEIIET KPDFKLQKIP LSFYMGDKRI ERLMTKKTEH CLAVLQIEEQ KKAVNTFFGI      1080
     LKHYSDQPLS NIKPNELAQL RLAFVEIQSA MANSNLELSN DFVAALNQLE TSPPEKTKKI      1140
     QVTVSQLLKV QPAVETYLNE HKKSSELKIA VIDKAIEHVK DKSFELKSGA SKEINIPQLR      1200
     KTFLETESKK PVVGPGELKP TSVSSLNTVR GNLAYIQELK ISSTVGMMRE QFSALTRDNF      1260
     SNRVQKYLIK PQDKPLHMIN DNDPLMVRQI KEVENGLYHL ETALKQFEQM KKSDSLVSQT      1320
     KALLEIANHA LQLKMAVERF SPELKEHYGP LVRTVLSFSN KIQSINYNKE DWADLQFILN      1380
     RAHKELLKRK TPRDHRIEKA FFEAGVREVQ IDRDESVGKK AAKLGVKYAH LASPQLEKAR      1440
     AYLSSRYKNA FGQQPKVIRS FTREQLANEE FMDAEISRLK ETLEEKYGFN IATIKVLLDL      1500
     LEQIQRAGAQ AAEVAGMVNT LVTYDFPKIK ENAYRDLLTK LSQEEDYLNL KPGTLINPAM      1560
     AAVNQLFLSA ALELDMPFSK KLSILDDTTY VNILIRQTES DLQTLKEKLS EDPSNHEIAF      1620
     EIEIKNDKLA FLRQQMVLLE DKNPNQTRNV LMDMQFEVSL RNHLVYTTLK APIAQEYEQI      1680
     AIEYYKKNKN RFLYADDCSK ELLQGLKEFE KKHLPDHLIV FEAYDRLRLF SAKLPPKNQD      1740
     VKEYIENINR ELQNRDIPIR QRALKVKLLP NDTVFIEKLI SADKGTHFLR KFMQFITIIT      1800
     ASITEAIKTG GSLVYIYRQK QMEQSIKNIE KSISFKEELH TIKDPDGPSP RKEEGQEGEI      1860
     EFTKL                                                                  1865
//

If you have problems or comments...

PBIL Back to PBIL home page