(data stored in ACNUC7421 zone)

EMBL: CP000675.SDHC

CP000675.SDHC        Location/Qualifiers
FT   CDS             659759..660133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="LPC_2774"
FT                   /product="succinate dehydrogenase cytochrome b556 subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2774"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56677"
FT                   /protein_id="ABQ56677.1"
FT                   /translation="MNKKRPINLDLSSLKFPPMAIASILHRVSGVLIFLLFPFVLFILG
FT                   CSLQSEESFAQTKIILANPYYKLLLWAFGASMIYHVIAGIRHLIMDMGFGESLRAGRMS
FT                   AVSIIALAVILAIFLGIWIW"
     MNKKRPINLD LSSLKFPPMA IASILHRVSG VLIFLLFPFV LFILGCSLQS EESFAQTKII        60
     LANPYYKLLL WAFGASMIYH VIAGIRHLIM DMGFGESLRA GRMSAVSIIA LAVILAIFLG       120
     IWIW                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page