(data stored in ACNUC7421 zone)

EMBL: CP000675.SDHD

CP000675.SDHD        Location/Qualifiers
FT   CDS             660127..660474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="LPC_2773"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2773"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56676"
FT                   /protein_id="ABQ56676.1"
FT                   /translation="MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNF
FT                   SQWHLLFANKIFQIATTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLGQ
FT                   FIWGLMIIWGQ"
     MVNNVTSLTG NGLKDWLIQR VTAVYFAAYL IFLFGFILAN PDLNFSQWHL LFANKIFQIA        60
     TTIGLMALTL HAWIGIWTVT TDYMKCTVIR LSVQLLVVLW LLGQFIWGLM IIWGQ            115
//

If you have problems or comments...

PBIL Back to PBIL home page