(data stored in ACNUC7421 zone)

EMBL: CP000675.SIDA

CP000675.SIDA        Location/Qualifiers
FT   CDS             complement(751289..752713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidA"
FT                   /locus_tag="LPC_2673"
FT                   /product="SidA protein, substrate of the Dot/Icm transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2673"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56586"
FT                   /protein_id="ABQ56586.1"
FT                   /translation="MAKKYRTPIPLSDKMMTLKKNLQDQLTQSQSLGEQIHAGTTAAST
FT                   ITTGVSHVFNVIDSFLSAYRQIPLVGGILQLVATVAKSISIVSDPEKSIAEKIISSILI
FT                   AAIIALSITAITLGGLAAAIIGTVIASTVTIMEGLGFFGKIAEKFQLANSYKMKKEFID
FT                   LVAKRIEPDNDKYNDLLEIRAIELQHELEKSYPNQIEQQQLKEELNFINTVLRKKNITP
FT                   GNNKENDAYKLNQLYAKRAEQLKTLVDKIALINPTGKRAEQNKLLSEIKSLQKEITKTD
FT                   DSIEEIIAPLAKIERDNLKSTINLPLSYSTFAIAAASTLISIAGLLVVAGVIAAPPIMV
FT                   PIMFAVGSVMAIIGLIKWTAEKMAEIEDAQLKAEETAKHEDAVLDEALNVYEQQLNLEL
FT                   VSPANPARQVKNILTVQDKVPALSPTESTVSSLDSRFTLFGSSSREHTKIAEQKTNDTT
FT                   NEQAPTTFDSISKPTR"
     MAKKYRTPIP LSDKMMTLKK NLQDQLTQSQ SLGEQIHAGT TAASTITTGV SHVFNVIDSF        60
     LSAYRQIPLV GGILQLVATV AKSISIVSDP EKSIAEKIIS SILIAAIIAL SITAITLGGL       120
     AAAIIGTVIA STVTIMEGLG FFGKIAEKFQ LANSYKMKKE FIDLVAKRIE PDNDKYNDLL       180
     EIRAIELQHE LEKSYPNQIE QQQLKEELNF INTVLRKKNI TPGNNKENDA YKLNQLYAKR       240
     AEQLKTLVDK IALINPTGKR AEQNKLLSEI KSLQKEITKT DDSIEEIIAP LAKIERDNLK       300
     STINLPLSYS TFAIAAASTL ISIAGLLVVA GVIAAPPIMV PIMFAVGSVM AIIGLIKWTA       360
     EKMAEIEDAQ LKAEETAKHE DAVLDEALNV YEQQLNLELV SPANPARQVK NILTVQDKVP       420
     ALSPTESTVS SLDSRFTLFG SSSREHTKIA EQKTNDTTNE QAPTTFDSIS KPTR             474
//

If you have problems or comments...

PBIL Back to PBIL home page