(data stored in ACNUC7421 zone)

EMBL: CP000675.SIDE

CP000675.SIDE        Location/Qualifiers
FT   CDS             complement(327100..331590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidE"
FT                   /locus_tag="LPC_0309"
FT                   /product="SidE protein, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54304"
FT                   /protein_id="ABQ54304.1"
FT                   /translation="MPKYVEGIELTQEGMHAIFERMGHPNITSGTIYNGEPTIDKGALD
FT                   RQGFMPVLTGVSPRQDSGHWIMLIKGQGNQYYLFDPLGESSGKYYQNILAKKLPGATLS
FT                   VIPNNAGLNMGLCGYWVASVGLRAHAALTQPIPPSLRNLGQTITQEMRDELTQDGSEKI
FT                   TQWLRAVGNEFPDGDIQPDATALRRATEKNLRIDELQPVFAGTTPKEISINPTAPQETS
FT                   VPTWNGFSLYTDEIVRNAARYAYDNYLGKPYTGTVEATPVNFGGQMVYRQHHGLAHTLR
FT                   TMAYAEIIVEEARKAKLRGESLKTFADGRTLADVTPEELRKIMIAQAFFVTGRDDEESS
FT                   KNYEKYHEQSRDAFLKYVEDNKSALIPDVFKDEKDVKFYADVIEDKDHKWADSPAHVLV
FT                   NQGHMVDLVRVKQPPESYLEYYFSQLQPWIGSKAAEAVFAAQRQFFHATYEAVAGFNSE
FT                   NTEPHLVVDGLGRYVIGPDGNPIREEPDDEDEEESGELKFFSQKKKLEENQRYMRVDEY
FT                   LKLDEVQKRFPGAGKKLDGGLPGLNEYQYLQRLNSINRARCENDVDFCLGQLQTAHHQT
FT                   KITPIKRAFQSSSEKARRQPNMDEIAAARIVQQIMANPDCIHDDHVFLNGQKLEEKFFR
FT                   DLLAKCDMAIVGSLLNDTDIRNIDTLMQHERNTEFHSTDAKAKPVKLGETWEKTIRSGG
FT                   GVTQIKHDLIFLMQNDAWYHTRVNAIAQNRDKDSTFKEVLITALMTPLTNKSLIDTSRS
FT                   PAPKTLFRGLDLSEEFKNKLINQAETIIANTTEHLFTDLSTEAFKQIKLNDFSQVSART
FT                   CASTSTNIAVPRTIFGSNTIFEILDPDGLLHPKQVGTHVPGSESEYSIYLPEDVALVPI
FT                   KVSFDGKTVKGKDRHIFTLVAVKSPDFTPKHEIGYAVGPLLRMQTPKLEEIQRLVEQAR
FT                   EEPDLERVFNLQSRVARQAKLFSTEPGYKTFLNEKVAPVLEQSLNGLLDNNVTILGKVL
FT                   SAFPSDGQWSAFNSVEARQMKIQMDAIKQMVEKKAVLEGRILPALAQCQDALEKQNIDG
FT                   ALQALKNIPSEKEMQTMLSISSGLRGQIQRAKQNLTENLEPLQRAMTAKLVSDKEKVKV
FT                   RYEKLIAGIPQQITDLEKAALSDLAGVKKVVSHFNHLQEELKLLRNEKVRMHTGSEKVD
FT                   FSDIVQLEAQLQKIHTKLYDAYLVELTKEISALAKEKPKNLSDVKRMVSNFYAMSADIE
FT                   QLRQEKIKEHGESKDPIDMSDIDKLKKELQKINQFLVKAMGTNIRVSLNQMEVKTFDAQ
FT                   EKEAQQNLKQLDELINKLESSDAVQKQKEELEKLNQLLIEKRKAYPAMVQLQFRSEALI
FT                   IHLRELCEAHQAQMAKTRKARAQEITNGRWKVQWLTDWVGLTTDERVTLANKEKELAKF
FT                   KEDLNNDEYDLQELISNLAEKTPSELEEAIGISKESAQKLHKLLTHLNHSTTFMSKIEQ
FT                   RLQSIDELLNEFGKQSPRTEMIKTVEEKQGTLLRL"
     MPKYVEGIEL TQEGMHAIFE RMGHPNITSG TIYNGEPTID KGALDRQGFM PVLTGVSPRQ        60
     DSGHWIMLIK GQGNQYYLFD PLGESSGKYY QNILAKKLPG ATLSVIPNNA GLNMGLCGYW       120
     VASVGLRAHA ALTQPIPPSL RNLGQTITQE MRDELTQDGS EKITQWLRAV GNEFPDGDIQ       180
     PDATALRRAT EKNLRIDELQ PVFAGTTPKE ISINPTAPQE TSVPTWNGFS LYTDEIVRNA       240
     ARYAYDNYLG KPYTGTVEAT PVNFGGQMVY RQHHGLAHTL RTMAYAEIIV EEARKAKLRG       300
     ESLKTFADGR TLADVTPEEL RKIMIAQAFF VTGRDDEESS KNYEKYHEQS RDAFLKYVED       360
     NKSALIPDVF KDEKDVKFYA DVIEDKDHKW ADSPAHVLVN QGHMVDLVRV KQPPESYLEY       420
     YFSQLQPWIG SKAAEAVFAA QRQFFHATYE AVAGFNSENT EPHLVVDGLG RYVIGPDGNP       480
     IREEPDDEDE EESGELKFFS QKKKLEENQR YMRVDEYLKL DEVQKRFPGA GKKLDGGLPG       540
     LNEYQYLQRL NSINRARCEN DVDFCLGQLQ TAHHQTKITP IKRAFQSSSE KARRQPNMDE       600
     IAAARIVQQI MANPDCIHDD HVFLNGQKLE EKFFRDLLAK CDMAIVGSLL NDTDIRNIDT       660
     LMQHERNTEF HSTDAKAKPV KLGETWEKTI RSGGGVTQIK HDLIFLMQND AWYHTRVNAI       720
     AQNRDKDSTF KEVLITALMT PLTNKSLIDT SRSPAPKTLF RGLDLSEEFK NKLINQAETI       780
     IANTTEHLFT DLSTEAFKQI KLNDFSQVSA RTCASTSTNI AVPRTIFGSN TIFEILDPDG       840
     LLHPKQVGTH VPGSESEYSI YLPEDVALVP IKVSFDGKTV KGKDRHIFTL VAVKSPDFTP       900
     KHEIGYAVGP LLRMQTPKLE EIQRLVEQAR EEPDLERVFN LQSRVARQAK LFSTEPGYKT       960
     FLNEKVAPVL EQSLNGLLDN NVTILGKVLS AFPSDGQWSA FNSVEARQMK IQMDAIKQMV      1020
     EKKAVLEGRI LPALAQCQDA LEKQNIDGAL QALKNIPSEK EMQTMLSISS GLRGQIQRAK      1080
     QNLTENLEPL QRAMTAKLVS DKEKVKVRYE KLIAGIPQQI TDLEKAALSD LAGVKKVVSH      1140
     FNHLQEELKL LRNEKVRMHT GSEKVDFSDI VQLEAQLQKI HTKLYDAYLV ELTKEISALA      1200
     KEKPKNLSDV KRMVSNFYAM SADIEQLRQE KIKEHGESKD PIDMSDIDKL KKELQKINQF      1260
     LVKAMGTNIR VSLNQMEVKT FDAQEKEAQQ NLKQLDELIN KLESSDAVQK QKEELEKLNQ      1320
     LLIEKRKAYP AMVQLQFRSE ALIIHLRELC EAHQAQMAKT RKARAQEITN GRWKVQWLTD      1380
     WVGLTTDERV TLANKEKELA KFKEDLNNDE YDLQELISNL AEKTPSELEE AIGISKESAQ      1440
     KLHKLLTHLN HSTTFMSKIE QRLQSIDELL NEFGKQSPRT EMIKTVEEKQ GTLLRL          1496
//

If you have problems or comments...

PBIL Back to PBIL home page