(data stored in ACNUC7421 zone)

EMBL: CP000675.SPMB

CP000675.SPMB        Location/Qualifiers
FT   CDS             695890..696423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spmB"
FT                   /locus_tag="LPC_2733"
FT                   /product="spore maturation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2733"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56640"
FT                   /protein_id="ABQ56640.1"
FT                   /translation="MNGFANHLSNWLFLTFIVGIPLYAAIKKVNVFDAFIIGAKQGFDV
FT                   SVKLIPYLVAMMVAIGMLRASGFFSLMSQILSPALAMIGMPSELLPLALIRPFSGSAST
FT                   GVMAELIHKYGGDSFIAKTAATMMGSTETTFYVIAVYFGSVGIRRTRHAIPAGLLADLA
FT                   GIIASVLICRYLFT"
     MNGFANHLSN WLFLTFIVGI PLYAAIKKVN VFDAFIIGAK QGFDVSVKLI PYLVAMMVAI        60
     GMLRASGFFS LMSQILSPAL AMIGMPSELL PLALIRPFSG SASTGVMAEL IHKYGGDSFI       120
     AKTAATMMGS TETTFYVIAV YFGSVGIRRT RHAIPAGLLA DLAGIIASVL ICRYLFT          177
//

If you have problems or comments...

PBIL Back to PBIL home page