(data stored in ACNUC7421 zone)

EMBL: CP000675.SSB

CP000675.SSB         Location/Qualifiers
FT   CDS             complement(450337..450816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="LPC_2988"
FT                   /product="Single-strand binding protein (SSB)
FT                   (Helix-destabilizing protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2988"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56889"
FT                   /protein_id="ABQ56889.1"
FT                   /translation="MARGINKVILVGNVGADPDVRYLPNGNAVTTLSVATSETWKDKTT
FT                   GEKQDRTEWHRVVCFNRLGEIAGEYIRKGSKLYVEGSLRTRKWQDQQGQDRYTTEIVAS
FT                   DIQMLDSKGNGATNYDDMPSFQGTSTPQQASTKNQATPTSTAQDAFDELDDDIPF"
     MARGINKVIL VGNVGADPDV RYLPNGNAVT TLSVATSETW KDKTTGEKQD RTEWHRVVCF        60
     NRLGEIAGEY IRKGSKLYVE GSLRTRKWQD QQGQDRYTTE IVASDIQMLD SKGNGATNYD       120
     DMPSFQGTST PQQASTKNQA TPTSTAQDAF DELDDDIPF                              159
//

If you have problems or comments...

PBIL Back to PBIL home page