(data stored in ACNUC7421 zone)

EMBL: CP000675.TDK

CP000675.TDK         Location/Qualifiers
FT   CDS             771008..771637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="LPC_2658"
FT                   /product="thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2658"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56571"
FT                   /protein_id="ABQ56571.1"
FT                   /translation="MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQ
FT                   YGTICSRIGLSEQAYAFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEI
FT                   TDQMSIPVLAYGLRTDFRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQ
FT                   AVVEGEQVLIGGNESYVATCRLHYKLGEAGKTFPRNKLFNKDTNTF"
     MAKLYFYYAA MNAGKSTVLL QSSYNYRERG MQTLLFTPAI DTRFQYGTIC SRIGLSEQAY        60
     AFNNSDNLYV LTQEFQLQTQ KYSCVLIDEA QFLTREQVYQ LTEITDQMSI PVLAYGLRTD       120
     FRGELFPGSQ FLLAWADELI ELKTICHCGR KAIMNMRIDE NGQAVVEGEQ VLIGGNESYV       180
     ATCRLHYKLG EAGKTFPRNK LFNKDTNTF                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page