(data stored in ACNUC7421 zone)

EMBL: CP000675.TPHA

CP000675.TPHA        Location/Qualifiers
FT   CDS             complement(548469..549725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tphA"
FT                   /locus_tag="LPC_2886"
FT                   /product="proline/betaine transport protein like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2886"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56787"
FT                   /protein_id="ABQ56787.1"
FT                   /translation="MNQNTKHSIIAGLYGNALEWYDFLLYASFAPVFAEIFFPSKIHFV
FT                   SLIATFSLFAIGFIMRPIGGLLLGHYADHVGRRKALILSMSVMTISTALIAVLPDFNSW
FT                   GIIAPLLFSILRLIQGLAVGGELPGSTTYLIEHMFQQSRELAGSLVLSSAFLGIFIGAL
FT                   TASIFSTLFTGDALLNWGWRYAYLLGGILGILGIYLRIKSFESPTFLKDKHTAELPAKV
FT                   VFTRFKQQLFLSVIITSILAMSNYVLIAYVTTFLVKSEYFLLKDALLINLIALALLTVL
FT                   IPLMGFLSDVVGRKPIFLIGLFSLCILIFPFFWLLLSGSWWKALCSELLLAIALAPINA
FT                   TVPTIIAEMFPTSVRASGISISYNIGQALFGGTMPLVAFTLIELSSNKMAPAWYLFLWI
FT                   LIVIPITISIRESYQKELT"
     MNQNTKHSII AGLYGNALEW YDFLLYASFA PVFAEIFFPS KIHFVSLIAT FSLFAIGFIM        60
     RPIGGLLLGH YADHVGRRKA LILSMSVMTI STALIAVLPD FNSWGIIAPL LFSILRLIQG       120
     LAVGGELPGS TTYLIEHMFQ QSRELAGSLV LSSAFLGIFI GALTASIFST LFTGDALLNW       180
     GWRYAYLLGG ILGILGIYLR IKSFESPTFL KDKHTAELPA KVVFTRFKQQ LFLSVIITSI       240
     LAMSNYVLIA YVTTFLVKSE YFLLKDALLI NLIALALLTV LIPLMGFLSD VVGRKPIFLI       300
     GLFSLCILIF PFFWLLLSGS WWKALCSELL LAIALAPINA TVPTIIAEMF PTSVRASGIS       360
     ISYNIGQALF GGTMPLVAFT LIELSSNKMA PAWYLFLWIL IVIPITISIR ESYQKELT         418
//

If you have problems or comments...

PBIL Back to PBIL home page