(data stored in ACNUC7421 zone)

EMBL: CP000675.TRAD

CP000675.TRAD        Location/Qualifiers
FT   CDS             198108..198272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="LPC_0183"
FT                   /product="Protein traD"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54182"
FT                   /protein_id="ABQ54182.1"
FT                   /translation="MNKDTELMDVITDKLEDLMVPGFVAEISPLEAEIMGAFSEEALSE
FT                   MDAKEAAYD"
     MNKDTELMDV ITDKLEDLMV PGFVAEISPL EAEIMGAFSE EALSEMDAKE AAYD              54
//

If you have problems or comments...

PBIL Back to PBIL home page