(data stored in ACNUC7421 zone)

EMBL: CP000675.TRAF

CP000675.TRAF        Location/Qualifiers
FT   CDS             197566..198111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="LPC_0182"
FT                   /product="Conjugal transfer protein traF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54181"
FT                   /protein_id="ABQ54181.1"
FT                   /translation="MKKFMAWVAVVLLGLISLSFLLIIMGFRVNITDSIPVGLYRITNL
FT                   KNLKNAFVIFCPDDRPAFKQGLDRGYVEKGLCPGGYGYLMKKVVATSGDKVSVISEGVF
FT                   VNRQFLPYSKPKLTDGMNYALPQWRAIDYQLKEDEILTMTNQSEWSFDARYYGPIRLGQ
FT                   IKGVITPVWVKAKMERKT"
     MKKFMAWVAV VLLGLISLSF LLIIMGFRVN ITDSIPVGLY RITNLKNLKN AFVIFCPDDR        60
     PAFKQGLDRG YVEKGLCPGG YGYLMKKVVA TSGDKVSVIS EGVFVNRQFL PYSKPKLTDG       120
     MNYALPQWRA IDYQLKEDEI LTMTNQSEWS FDARYYGPIR LGQIKGVITP VWVKAKMERK       180
     T                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page