(data stored in ACNUC7421 zone)

EMBL: CP000675.TRAG

CP000675.TRAG        Location/Qualifiers
FT   CDS             195680..197569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="LPC_0181"
FT                   /product="Conjugal transfer protein traG"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54180"
FT                   /protein_id="ABQ54180.1"
FT                   /translation="MSMSKPNKSIGPQVRKKRVEKTNKQIVFLVVLALFVSMQIGTQFV
FT                   AYKLHYHQSLGFSVAHIYLPWQLLWWNLQYHSIYPDYFNAAFGLVAMSGSLFLMIILFV
FT                   SKQLTQENVSEYLHGSARWANQDDLKDAGLIGNEEGVYVGAVENEKGDIHYLRHNGPEH
FT                   ILTYAPTRSGKGVGLVIPTLLSWKQSCVITDLKGELWALTAGWRQKHANNKVIRFEPAT
FT                   LKGSARWNPLDEIRVGTEYEVGDVQNLATLVVDPDGKGLETHWQKTSQALLVGFILHAI
FT                   YKLKNQGEPATFPNIDRMLVDPNTNIADLLIEMTQYPHIDGKTHPVISASARDMIDRPE
FT                   EEAGSVLSTLKSYLALYRDPVVAHNVSASDFCIKDLMHHNNPVSLYIVTQPNDKARLQP
FT                   LVRVMLNMVVRLLADRMEFERVDDGKGNRFVRTKRNYKHRLLCMIDEFPSLGKLDILQE
FT                   SLAFVAGYGLKFYLICQDINQLKSRERGYGPDETITSNCHIQNAYPPNRIETAEHLSKL
FT                   TGQTTIVKEHITTSGKRVSTFLNQISKTKQEVSRPLLTIDECQRMPGPKKDANGLITEA
FT                   GDMVVYVAGFPAIYGKQPLYFKDPVFIARASVESPEQSDILRTRLSEDEEIRL"
     MSMSKPNKSI GPQVRKKRVE KTNKQIVFLV VLALFVSMQI GTQFVAYKLH YHQSLGFSVA        60
     HIYLPWQLLW WNLQYHSIYP DYFNAAFGLV AMSGSLFLMI ILFVSKQLTQ ENVSEYLHGS       120
     ARWANQDDLK DAGLIGNEEG VYVGAVENEK GDIHYLRHNG PEHILTYAPT RSGKGVGLVI       180
     PTLLSWKQSC VITDLKGELW ALTAGWRQKH ANNKVIRFEP ATLKGSARWN PLDEIRVGTE       240
     YEVGDVQNLA TLVVDPDGKG LETHWQKTSQ ALLVGFILHA IYKLKNQGEP ATFPNIDRML       300
     VDPNTNIADL LIEMTQYPHI DGKTHPVISA SARDMIDRPE EEAGSVLSTL KSYLALYRDP       360
     VVAHNVSASD FCIKDLMHHN NPVSLYIVTQ PNDKARLQPL VRVMLNMVVR LLADRMEFER       420
     VDDGKGNRFV RTKRNYKHRL LCMIDEFPSL GKLDILQESL AFVAGYGLKF YLICQDINQL       480
     KSRERGYGPD ETITSNCHIQ NAYPPNRIET AEHLSKLTGQ TTIVKEHITT SGKRVSTFLN       540
     QISKTKQEVS RPLLTIDECQ RMPGPKKDAN GLITEAGDMV VYVAGFPAIY GKQPLYFKDP       600
     VFIARASVES PEQSDILRTR LSEDEEIRL                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page