(data stored in ACNUC7421 zone)

EMBL: CP000675.TRAI

CP000675.TRAI        Location/Qualifiers
FT   CDS             complement(202055..203929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="LPC_0187"
FT                   /product="TraI protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54186"
FT                   /protein_id="ABQ54186.1"
FT                   /translation="MIIHHIPMKSARLSSFSGLVKYITDHQNKQERVGKVRISNCNSVD
FT                   PTWAVQEILATQARNQRAKGDKTYHLLISFAPGENPPEEVLNIIEDRVISSVGFKDHQR
FT                   ISVIHHDTDNLHIHVAINKIHPKTFNMIEPYRAYRTFAEVASTLEIEFGLEITNHQARK
FT                   GRSENLADDMEQHSGIESLINWMKRNCREQIESANSWNDVHRILTDHGLEILIRANGFV
FT                   FCDKKALTVKASAVSRSFSKKNLEERLGEFIPSPFGNEYYTQNVYRYEPLNKKVIGSEI
FT                   YARYLYEKEHSKTHLSKKLKQLGEAKARLIDKAKKRGRIKRKALKLMKASRSQKKYLYQ
FT                   QISKTLLKDIEKTRQNYAKERKHLLESHQTKIWADWLRQKAELGDKDAITALRYRNRKN
FT                   QSKYALSAASSNFSFANIAQVDSITKEGTEIYKLDKAVIRDDGKEIKISKGGSIATLKK
FT                   AIEMAQQRYGDCIQVNGSPLFKKIILQIVTQNNIPITFADSELEAQRQKMISEQENQNE
FT                   QSRRYGFNDGRRTSRSNEAAGEAIGESGSHFRSQPNAVSIRQGPPAKGQNSLRDLSQLD
FT                   VVQFTGRGKVLLPDNAHDQLERERLQPDNHVRRDVSGLKKKGKILNNK"
     MIIHHIPMKS ARLSSFSGLV KYITDHQNKQ ERVGKVRISN CNSVDPTWAV QEILATQARN        60
     QRAKGDKTYH LLISFAPGEN PPEEVLNIIE DRVISSVGFK DHQRISVIHH DTDNLHIHVA       120
     INKIHPKTFN MIEPYRAYRT FAEVASTLEI EFGLEITNHQ ARKGRSENLA DDMEQHSGIE       180
     SLINWMKRNC REQIESANSW NDVHRILTDH GLEILIRANG FVFCDKKALT VKASAVSRSF       240
     SKKNLEERLG EFIPSPFGNE YYTQNVYRYE PLNKKVIGSE IYARYLYEKE HSKTHLSKKL       300
     KQLGEAKARL IDKAKKRGRI KRKALKLMKA SRSQKKYLYQ QISKTLLKDI EKTRQNYAKE       360
     RKHLLESHQT KIWADWLRQK AELGDKDAIT ALRYRNRKNQ SKYALSAASS NFSFANIAQV       420
     DSITKEGTEI YKLDKAVIRD DGKEIKISKG GSIATLKKAI EMAQQRYGDC IQVNGSPLFK       480
     KIILQIVTQN NIPITFADSE LEAQRQKMIS EQENQNEQSR RYGFNDGRRT SRSNEAAGEA       540
     IGESGSHFRS QPNAVSIRQG PPAKGQNSLR DLSQLDVVQF TGRGKVLLPD NAHDQLERER       600
     LQPDNHVRRD VSGLKKKGKI LNNK                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page