(data stored in ACNUC7421 zone)

EMBL: CP000675.TRAJ

CP000675.TRAJ        Location/Qualifiers
FT   CDS             complement(203926..204279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="LPC_0188"
FT                   /product="TraJ protein (Relaxosome protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54187"
FT                   /protein_id="ABQ54187.1"
FT                   /translation="MVEKIKKPIRKHGRHLRVPVLPDEEIAIKSHAAQAGLSVAEYLRR
FT                   IGLGYQIQSAIDKEYILQLSKINADMGRLGGLFKLWLTQDRRVAHFDYRKVKALLDRIK
FT                   TTQDVMFEVVRKL"
     MVEKIKKPIR KHGRHLRVPV LPDEEIAIKS HAAQAGLSVA EYLRRIGLGY QIQSAIDKEY        60
     ILQLSKINAD MGRLGGLFKL WLTQDRRVAH FDYRKVKALL DRIKTTQDVM FEVVRKL          117
//

If you have problems or comments...

PBIL Back to PBIL home page