(data stored in ACNUC7421 zone)

EMBL: CP000675.TRAL

CP000675.TRAL        Location/Qualifiers
FT   CDS             638266..638991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traL"
FT                   /locus_tag="LPC_2792"
FT                   /product="traL protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2792"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56693"
FT                   /protein_id="ABQ56693.1"
FT                   /translation="MAKIHITMQGKGGVGKSFVSATTAQYKLNKAQSPLCIDTDPINAT
FT                   FHGFKSLNVERLNIMEGDEINPRHFDTLIEKIANTQNDVIIDNGASSFVPLSHYLIANQ
FT                   VPTLLKDMGHELIIHTVITGGQALLDTINGFAQLVNQFPEDIRYVVWLNPYWGKIESEG
FT                   KPFEQLRVYKETKDRIAAIINIPDLKEETFGHDLSNMLQQKITFNEAIDSPDRNIMTRQ
FT                   RLKLIRDQLFSQIDNATVI"
     MAKIHITMQG KGGVGKSFVS ATTAQYKLNK AQSPLCIDTD PINATFHGFK SLNVERLNIM        60
     EGDEINPRHF DTLIEKIANT QNDVIIDNGA SSFVPLSHYL IANQVPTLLK DMGHELIIHT       120
     VITGGQALLD TINGFAQLVN QFPEDIRYVV WLNPYWGKIE SEGKPFEQLR VYKETKDRIA       180
     AIINIPDLKE ETFGHDLSNM LQQKITFNEA IDSPDRNIMT RQRLKLIRDQ LFSQIDNATV       240
     I                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page