(data stored in ACNUC7421 zone)

EMBL: CP000675.TRAM

CP000675.TRAM        Location/Qualifiers
FT   CDS             638991..639440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traM"
FT                   /locus_tag="LPC_2791"
FT                   /product="traM protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2791"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56692"
FT                   /protein_id="ABQ56692.1"
FT                   /translation="MSDKINEAIQYIAGKHGVVLGRDDPVLILQTMNDRLLEENRKAQQ
FT                   EMLAQLKEEMENISSQWKVDAKEKAEKVLNAALASSKEAMNKILREATNESVHVMKKLI
FT                   SDSLTEANDLTQQTRKANRFTLLASASMMTVSCAFMLFLLINFAR"
     MSDKINEAIQ YIAGKHGVVL GRDDPVLILQ TMNDRLLEEN RKAQQEMLAQ LKEEMENISS        60
     QWKVDAKEKA EKVLNAALAS SKEAMNKILR EATNESVHVM KKLISDSLTE ANDLTQQTRK       120
     ANRFTLLASA SMMTVSCAFM LFLLINFAR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page