(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBC

CP000675.TRBC        Location/Qualifiers
FT   CDS             186788..187165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /locus_tag="LPC_0171"
FT                   /product="Conjugal transfer protein trbC"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54170"
FT                   /protein_id="ABQ54170.1"
FT                   /translation="MTQVSTLNYKKMWMMGLVVLFLLFITHPAMASTAGGGLPFDSWLT
FT                   KIQKSITGPFAFSAAIIGLVAAGATLIFGGDMNGFMRTLVFFVLVLSFLVAAQNTMTAI
FT                   TGKGAEISKPSTEVNAAEHQL"
     MTQVSTLNYK KMWMMGLVVL FLLFITHPAM ASTAGGGLPF DSWLTKIQKS ITGPFAFSAA        60
     IIGLVAAGAT LIFGGDMNGF MRTLVFFVLV LSFLVAAQNT MTAITGKGAE ISKPSTEVNA       120
     AEHQL                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page