(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBD

CP000675.TRBD        Location/Qualifiers
FT   CDS             187162..187461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="LPC_0172"
FT                   /product="Conjugal transfer protein trbD"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54171"
FT                   /protein_id="ABQ54171.1"
FT                   /translation="MSLRTIPIRKCGNRPNLFLGGDRELVMFSGLLSAILVFAAQDWLA
FT                   AIAGMVMWFLSLKGLRLMAKSDPFMRAIYLRQRSYQAYYAPRSTPFRENKRGYQ"
     MSLRTIPIRK CGNRPNLFLG GDRELVMFSG LLSAILVFAA QDWLAAIAGM VMWFLSLKGL        60
     RLMAKSDPFM RAIYLRQRSY QAYYAPRSTP FRENKRGYQ                               99
//

If you have problems or comments...

PBIL Back to PBIL home page