(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBE

CP000675.TRBE        Location/Qualifiers
FT   CDS             187458..189995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="LPC_0173"
FT                   /product="Conjugal transfer protein trbE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54172"
FT                   /protein_id="ABQ54172.1"
FT                   /translation="MIPVITFLLSLTGLIFLSFLFYQTRLNSQTHHLKKHRQQKAGFVD
FT                   LLNYAALVDDGVIIGKNGSFMAAWLYSGEDHANSTDKAREMVSFRINQALSAMGSGWMV
FT                   HVDAIRRAAPSYSERGCSHFPDPISLAVDEERRQLFERLGTLYEGYFVITLTWYPPVLA
FT                   QKRFEALMFDDNQARLSQKAKTHQLIEEFKQSCRNFESRMSSALNLERLQSEKIINEQG
FT                   STVIQDNFLRHLQFCATGLNHPVNLPKNPIYLDALIGGQELLTGITPKIGKKFIQCVAI
FT                   EGFPMESYPGILTALTLLPIEYRWSSRFIFLDAHEAVAHFTKFRKKWKQKVRGFFDQIF
FT                   HTHSGAIDEDALNMVEDAQAAIAETNSGLVGQGYFTSVVILMDEDRALVEKAALFIEKN
FT                   INALGFTARLETINTMDAFMGSLPGHGVENIRRPLINTMNLADLLPTSNIWTGENKAPC
FT                   PLFPPLSPPLMHCITSGNAPFRLNLHVRDLGHGIMFGPTRSGKSTHLGLIALSWRRYKD
FT                   ARIYSFDKGMSMYPTCKATGGEHYTIADKDSKLAFAPLQFLSTSADRAWAMEWIDTILA
FT                   LNGLNTTPAQRNEIGHAVISMHKSGSKTLSEFVMTIQDEQIRETLKQYTIDGLMGHLLD
FT                   AESDGLGLSSFMTFEIEHLMGLGEKFALPVLLYLFRRIETSLDGRPTLILLDEAWLMLA
FT                   HPVFKNKIAEWLDSMAKKNCVVFMATQHLSHAANSGILDTIVESTATKIFLPNLYARDP
FT                   ETRLIYERMGLNPRQIDIIASAQPKRDYYYVSEKGQRLYQLALGPLALAFVGATDPDSI
FT                   ERMKQLEDKYGAEWVSFWLSEKGVDIKSHGVAA"
     MIPVITFLLS LTGLIFLSFL FYQTRLNSQT HHLKKHRQQK AGFVDLLNYA ALVDDGVIIG        60
     KNGSFMAAWL YSGEDHANST DKAREMVSFR INQALSAMGS GWMVHVDAIR RAAPSYSERG       120
     CSHFPDPISL AVDEERRQLF ERLGTLYEGY FVITLTWYPP VLAQKRFEAL MFDDNQARLS       180
     QKAKTHQLIE EFKQSCRNFE SRMSSALNLE RLQSEKIINE QGSTVIQDNF LRHLQFCATG       240
     LNHPVNLPKN PIYLDALIGG QELLTGITPK IGKKFIQCVA IEGFPMESYP GILTALTLLP       300
     IEYRWSSRFI FLDAHEAVAH FTKFRKKWKQ KVRGFFDQIF HTHSGAIDED ALNMVEDAQA       360
     AIAETNSGLV GQGYFTSVVI LMDEDRALVE KAALFIEKNI NALGFTARLE TINTMDAFMG       420
     SLPGHGVENI RRPLINTMNL ADLLPTSNIW TGENKAPCPL FPPLSPPLMH CITSGNAPFR       480
     LNLHVRDLGH GIMFGPTRSG KSTHLGLIAL SWRRYKDARI YSFDKGMSMY PTCKATGGEH       540
     YTIADKDSKL AFAPLQFLST SADRAWAMEW IDTILALNGL NTTPAQRNEI GHAVISMHKS       600
     GSKTLSEFVM TIQDEQIRET LKQYTIDGLM GHLLDAESDG LGLSSFMTFE IEHLMGLGEK       660
     FALPVLLYLF RRIETSLDGR PTLILLDEAW LMLAHPVFKN KIAEWLDSMA KKNCVVFMAT       720
     QHLSHAANSG ILDTIVESTA TKIFLPNLYA RDPETRLIYE RMGLNPRQID IIASAQPKRD       780
     YYYVSEKGQR LYQLALGPLA LAFVGATDPD SIERMKQLED KYGAEWVSFW LSEKGVDIKS       840
     HGVAA                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page