(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBF

CP000675.TRBF        Location/Qualifiers
FT   CDS             189992..190735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="LPC_0174"
FT                   /product="Conjugal transfer protein trbF"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54173"
FT                   /protein_id="ABQ54173.1"
FT                   /translation="MNKLKQWLNRLNTECKKSNLTDNPYLNAKRAWNVHTAGLMKSLQV
FT                   WQLVGLGSLLITLAAVGGLISIGSQSKFIPLVFQQDANGNTLSITRADRISQPSIDDYR
FT                   ATAAHFIENIRMVSADVELQKKAVFQVYSYLNQNDAALAKVQEFYNDKQHSNPFERAAH
FT                   EIVNVEIRSVLQESDKTWQVDWVETVRNRDGSIKEKPYVMKAMLTMYQDETLNDISSES
FT                   ILKNPHLIFIRDFNWSYDLKHGESR"
     MNKLKQWLNR LNTECKKSNL TDNPYLNAKR AWNVHTAGLM KSLQVWQLVG LGSLLITLAA        60
     VGGLISIGSQ SKFIPLVFQQ DANGNTLSIT RADRISQPSI DDYRATAAHF IENIRMVSAD       120
     VELQKKAVFQ VYSYLNQNDA ALAKVQEFYN DKQHSNPFER AAHEIVNVEI RSVLQESDKT       180
     WQVDWVETVR NRDGSIKEKP YVMKAMLTMY QDETLNDISS ESILKNPHLI FIRDFNWSYD       240
     LKHGESR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page