(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBG

CP000675.TRBG        Location/Qualifiers
FT   CDS             190732..191607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="LPC_0175"
FT                   /product="conjugal transfer protein trbG precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54174"
FT                   /protein_id="ABQ54174.1"
FT                   /translation="MKKIILSIGLLLPFSIFAQDNDELSNRYFSQSMPKLTYQETQALK
FT                   IAGKWQKGDKTSKPFQSSDGSVSFVYGSGQISIVCAPLQVCDIALQPGELFNDMNVGDP
FT                   RFIVEPSITGSGRNQQIHLIIKPKDVGLDSSLVVTTDRRTYHFRLKSERFEFMPYISFI
FT                   YPDEAKEKWRLIQKIQAENRKANTFPETNEYLGNLNFNYRIQGNARFKPVRVYNDGVKT
FT                   IIEMPKAMAQFEAPALLVLRKHGFLQKSKPVMVNYRLQGCRYIVDSVFDKAMLVVGSGS
FT                   AQEKITITRC"
     MKKIILSIGL LLPFSIFAQD NDELSNRYFS QSMPKLTYQE TQALKIAGKW QKGDKTSKPF        60
     QSSDGSVSFV YGSGQISIVC APLQVCDIAL QPGELFNDMN VGDPRFIVEP SITGSGRNQQ       120
     IHLIIKPKDV GLDSSLVVTT DRRTYHFRLK SERFEFMPYI SFIYPDEAKE KWRLIQKIQA       180
     ENRKANTFPE TNEYLGNLNF NYRIQGNARF KPVRVYNDGV KTIIEMPKAM AQFEAPALLV       240
     LRKHGFLQKS KPVMVNYRLQ GCRYIVDSVF DKAMLVVGSG SAQEKITITR C                291
//

If you have problems or comments...

PBIL Back to PBIL home page