(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBI

CP000675.TRBI        Location/Qualifiers
FT   CDS             192026..193267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="LPC_0177"
FT                   /product="Conjugal transfer protein trbI"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54176"
FT                   /protein_id="ABQ54176.1"
FT                   /translation="MHKNNDYLSPDSSPQKLQTTGVKRVNNMPLFIAIGVLTVFVLLIA
FT                   FVALKRANAQNLVTEPAKLTTAKKNTMSLAYEVIGNRKPETNQPVVNAPEPTLPVPPPQ
FT                   NTHENQSLDAQSVPDAEMERIRQEKTQAFEEAVNAKTSIMVDNARLNAREITNASTINH
FT                   DTTTEVNVVLNFKEQLNKLQARQNARPMPQTLGGEEGESRWHLNSRLESPNSRFELRAG
FT                   SVIPGVMVSGISSELPGQIIGQVSQNVYDTATGKYLLIPQGTKVIGLYSSDVSFGQDSV
FT                   LVAWQRLVFPDGKALDIGSMPGADNAGYAGFRDQVDHHYARIYGSALLMSGIVAGITYS
FT                   QNTNQTNPYGYNQPTAGSVLSQALGQQLGEVTSQMVSKNLNISPTINIRPGYRFNIIVI
FT                   KDLTFKSPYRQFAY"
     MHKNNDYLSP DSSPQKLQTT GVKRVNNMPL FIAIGVLTVF VLLIAFVALK RANAQNLVTE        60
     PAKLTTAKKN TMSLAYEVIG NRKPETNQPV VNAPEPTLPV PPPQNTHENQ SLDAQSVPDA       120
     EMERIRQEKT QAFEEAVNAK TSIMVDNARL NAREITNAST INHDTTTEVN VVLNFKEQLN       180
     KLQARQNARP MPQTLGGEEG ESRWHLNSRL ESPNSRFELR AGSVIPGVMV SGISSELPGQ       240
     IIGQVSQNVY DTATGKYLLI PQGTKVIGLY SSDVSFGQDS VLVAWQRLVF PDGKALDIGS       300
     MPGADNAGYA GFRDQVDHHY ARIYGSALLM SGIVAGITYS QNTNQTNPYG YNQPTAGSVL       360
     SQALGQQLGE VTSQMVSKNL NISPTINIRP GYRFNIIVIK DLTFKSPYRQ FAY              413
//

If you have problems or comments...

PBIL Back to PBIL home page