(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBJ

CP000675.TRBJ        Location/Qualifiers
FT   CDS             193281..194021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="LPC_0178"
FT                   /product="Conjugal transfer protein trbJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54177"
FT                   /protein_id="ABQ54177.1"
FT                   /translation="MKLRLMLIFLWSANAFSNGAPVFDFANWLENGKIIVNQVHQYKTQ
FT                   IDQYNNQLQQYQNMLDNTKSLTSFQWDNANGVINNLLDATNTIDYYKQEAGSLQGYLDR
FT                   FQTEEYYQKSPCFNGDRRCTPAEMRKINQNKMAASVAQKRANDAMLKGIDKQQQNLKSD
FT                   SEKLRMLQTQAQGAQGQKQALQAASQLASNQSHQLLQIRGLLLAQQNAQATKDAAALNK
FT                   EAIQTAGDERFRSGTYHKSSGKKW"
     MKLRLMLIFL WSANAFSNGA PVFDFANWLE NGKIIVNQVH QYKTQIDQYN NQLQQYQNML        60
     DNTKSLTSFQ WDNANGVINN LLDATNTIDY YKQEAGSLQG YLDRFQTEEY YQKSPCFNGD       120
     RRCTPAEMRK INQNKMAASV AQKRANDAML KGIDKQQQNL KSDSEKLRML QTQAQGAQGQ       180
     KQALQAASQL ASNQSHQLLQ IRGLLLAQQN AQATKDAAAL NKEAIQTAGD ERFRSGTYHK       240
     SSGKKW                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page