(data stored in ACNUC7421 zone)

EMBL: CP000675.TRBL

CP000675.TRBL        Location/Qualifiers
FT   CDS             194211..195683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="LPC_0180"
FT                   /product="Probable conjugal transfer protein trbL"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54179"
FT                   /protein_id="ABQ54179.1"
FT                   /translation="MPVLNEAVIQKAQAINGNLMKKKTITYLAVFLLIGFSVNCHAHNS
FT                   SIDSRDLLDNILYRFSATASMWSQTILSYARYLFWSLATISMVWTYGLMALRKADIQEF
FT                   MAETVRFLVVVGFFYWLLDNGPAIATAIMDSMRKLAANAAGIDAHISPSDIVDVGFDIV
FT                   SKAIDNSSIWSPAATTVGLIVAGVILVVLALVSINMLIILITAWILTYAGVILLGFGGG
FT                   RWTQDIAIQYYKTMLGTALQAFSMILIIGIGKSFVDQYYAAMSNDILLKEMFIMLVVAI
FT                   LLLVLINKIPPVLSGIVSGGGPSGGGNGIGLGGALGAAGIAGTALAGAAGAASAHSAGG
FT                   LSALHAAFKAASQSVGAGDSGSFSGGNSGSKLGGLAQAMGQASKFAGSFSSHLASGAFD
FT                   VASEKLGSMKDSFSAKTAETTGGKIADAIQQRASSNAHSVTSNKTPATDNVTSMGAPEG
FT                   SFSSGSGEYNQESGGADEVSQFVNQKASGESL"
     MPVLNEAVIQ KAQAINGNLM KKKTITYLAV FLLIGFSVNC HAHNSSIDSR DLLDNILYRF        60
     SATASMWSQT ILSYARYLFW SLATISMVWT YGLMALRKAD IQEFMAETVR FLVVVGFFYW       120
     LLDNGPAIAT AIMDSMRKLA ANAAGIDAHI SPSDIVDVGF DIVSKAIDNS SIWSPAATTV       180
     GLIVAGVILV VLALVSINML IILITAWILT YAGVILLGFG GGRWTQDIAI QYYKTMLGTA       240
     LQAFSMILII GIGKSFVDQY YAAMSNDILL KEMFIMLVVA ILLLVLINKI PPVLSGIVSG       300
     GGPSGGGNGI GLGGALGAAG IAGTALAGAA GAASAHSAGG LSALHAAFKA ASQSVGAGDS       360
     GSFSGGNSGS KLGGLAQAMG QASKFAGSFS SHLASGAFDV ASEKLGSMKD SFSAKTAETT       420
     GGKIADAIQQ RASSNAHSVT SNKTPATDNV TSMGAPEGSF SSGSGEYNQE SGGADEVSQF       480
     VNQKASGESL                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page