(data stored in ACNUC7421 zone)

EMBL: CP000675.UVRB

CP000675.UVRB        Location/Qualifiers
FT   CDS             89806..91797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="LPC_0094"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54093"
FT                   /db_xref="GOA:A5I9P3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9P3"
FT                   /protein_id="ABQ54093.1"
FT                   /translation="MKDLFKIYSNYQPAGDQPTAIASLIDGLESGLAKQTLLGVTGSGK
FT                   TFTIAHVIQAMKRPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYYDYYQPEAYVPA
FT                   SDTFIEKDASINEHIEQMRLSATKALIERKDAIIVATVSAIYGLGDPDSYLRMLLHLSR
FT                   GEQSDQRKILKRLAEMQYTRTNLSLERGQFRVHGDVIDIFPADSEKEAIRIELFDDEVD
FT                   NIARFDPLTGEILQRLPRVTIFPKTHYVTPRERILETVEKVKAELQERLAELNAQNKLV
FT                   EAQRLEQRTCFDIEMMLELGYCSGIENYSRYLSNREAGEAPPTLFDYLPPDALLIIDES
FT                   HVTVPQIGGMYRGDRARKETLVNYGFRLPSALDNRPLRFEEFEERSPQTIYISATPGPY
FT                   EQEHSDNVAEQVVRPTGLIDPEVEIRPVKTQVDDLMSEIRQVIAQGSRILVTTLTKRMA
FT                   EDLTEYLSEHGIKVRYLHSDVDTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVALV
FT                   AILDADKEGFLRSERSLIQTIGRAARNVKGRAILYADTMTGSMQRALMETERRREKQKA
FT                   FNLKHGITPKGINKSVEDILEGAYIGKRKTMVAEQAPRYTHWSPQELAKQINALEKQMY
FT                   AHAQNMEFELAAKIRDEYLLLKEQLMKI"
     MKDLFKIYSN YQPAGDQPTA IASLIDGLES GLAKQTLLGV TGSGKTFTIA HVIQAMKRPT        60
     LIMAPNKTLA AQLYGEFKAF FPDNAVEYFV SYYDYYQPEA YVPASDTFIE KDASINEHIE       120
     QMRLSATKAL IERKDAIIVA TVSAIYGLGD PDSYLRMLLH LSRGEQSDQR KILKRLAEMQ       180
     YTRTNLSLER GQFRVHGDVI DIFPADSEKE AIRIELFDDE VDNIARFDPL TGEILQRLPR       240
     VTIFPKTHYV TPRERILETV EKVKAELQER LAELNAQNKL VEAQRLEQRT CFDIEMMLEL       300
     GYCSGIENYS RYLSNREAGE APPTLFDYLP PDALLIIDES HVTVPQIGGM YRGDRARKET       360
     LVNYGFRLPS ALDNRPLRFE EFEERSPQTI YISATPGPYE QEHSDNVAEQ VVRPTGLIDP       420
     EVEIRPVKTQ VDDLMSEIRQ VIAQGSRILV TTLTKRMAED LTEYLSEHGI KVRYLHSDVD       480
     TVERMEIIRD LRLGEFDVLV GINLLREGLD MPEVALVAIL DADKEGFLRS ERSLIQTIGR       540
     AARNVKGRAI LYADTMTGSM QRALMETERR REKQKAFNLK HGITPKGINK SVEDILEGAY       600
     IGKRKTMVAE QAPRYTHWSP QELAKQINAL EKQMYAHAQN MEFELAAKIR DEYLLLKEQL       660
     MKI                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page