(data stored in ACNUC7421 zone)

EMBL: CP000675.YFHG

CP000675.YFHG        Location/Qualifiers
FT   CDS             complement(290455..292242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhG"
FT                   /locus_tag="LPC_0279"
FT                   /product="fusion of two types of conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54274"
FT                   /protein_id="ABQ54274.1"
FT                   /translation="MPLDKLTGITFHAAIIAGCHRLIRHKQILNDINVFPVADGDTGDN
FT                   LSSTGMAIIEFSSAKTKLRGTLESIADASIIGARGNSGIIFSQFFNLLAKHLPLKEELY
FT                   FNDFSKIMVQVGKEIASVVTNPVQGTMITLIQKWATVCEIKQPNSLLAQAMLELLPLLS
FT                   VEVEQTKNSLNILQKANVVDAGALGFYYFVEGFTQFLQQSHTTDTANTHSPLSITEHPQ
FT                   LTCTTTEYRYCTEAVLKSASIDKNKLLHFLKEQGECASVTGNDRITRFHVHTNNPREIF
FT                   TSLYKDYTIQYPKVDDMQRQHELQFGKKYKIGLVTDSSADLPQDLIDEYQIHQIPLNIH
FT                   VDEHHLLDKHCFEANYFYTQLNSFRTYPKTSCMNPNFIEEKLAKIASHYDHVLVLSISS
FT                   KMSGTYDAFLTATKKYTNITVLDTKTNSGAHGLLLHYAGQLIASGNDIDTIAKLLGKAI
FT                   KNTYIFVMVNQFESMIRSGRVNKISGRIAQWVNIKPLVSIDSAGQGIMVSKCFSASRAR
FT                   NKLINFLQEKKDEAQLILEDYCIIHAGDKNQALLLAEMTTQAFNKPPTYIEPVSLAIGL
FT                   HAGQGCIAIAGRLRERNDY"
     MPLDKLTGIT FHAAIIAGCH RLIRHKQILN DINVFPVADG DTGDNLSSTG MAIIEFSSAK        60
     TKLRGTLESI ADASIIGARG NSGIIFSQFF NLLAKHLPLK EELYFNDFSK IMVQVGKEIA       120
     SVVTNPVQGT MITLIQKWAT VCEIKQPNSL LAQAMLELLP LLSVEVEQTK NSLNILQKAN       180
     VVDAGALGFY YFVEGFTQFL QQSHTTDTAN THSPLSITEH PQLTCTTTEY RYCTEAVLKS       240
     ASIDKNKLLH FLKEQGECAS VTGNDRITRF HVHTNNPREI FTSLYKDYTI QYPKVDDMQR       300
     QHELQFGKKY KIGLVTDSSA DLPQDLIDEY QIHQIPLNIH VDEHHLLDKH CFEANYFYTQ       360
     LNSFRTYPKT SCMNPNFIEE KLAKIASHYD HVLVLSISSK MSGTYDAFLT ATKKYTNITV       420
     LDTKTNSGAH GLLLHYAGQL IASGNDIDTI AKLLGKAIKN TYIFVMVNQF ESMIRSGRVN       480
     KISGRIAQWV NIKPLVSIDS AGQGIMVSKC FSASRARNKL INFLQEKKDE AQLILEDYCI       540
     IHAGDKNQAL LLAEMTTQAF NKPPTYIEPV SLAIGLHAGQ GCIAIAGRLR ERNDY            595
//

If you have problems or comments...

PBIL Back to PBIL home page