(data stored in ACNUC7421 zone)

EMBL: CP000675.YJEA

CP000675.YJEA        Location/Qualifiers
FT   CDS             886030..886725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeA"
FT                   /locus_tag="LPC_2581"
FT                   /product="endo-1,4-beta-xylanase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56496"
FT                   /protein_id="ABQ56496.1"
FT                   /translation="MPIQMNLINKIGLMFGLLFYSFLASAITTEVIKKETAEYLLDIKY
FT                   PQGFQSNGVNQAVKEFITNQQKSFMNELSEDADTPADAPGKTGLNITYAIPYQSTNALS
FT                   VRFNISIYHRGAAHPSNAVKVLNFIKNQPVQLSDLFVPGSDYLQPIADLAKKEITAKKI
FT                   SDENWIKEGTKPTQENYSIWHFTKKGIAIVFNTYQVAAYVYGEQTVDIPLSLISAMVKP
FT                   EISKAVWGN"
     MPIQMNLINK IGLMFGLLFY SFLASAITTE VIKKETAEYL LDIKYPQGFQ SNGVNQAVKE        60
     FITNQQKSFM NELSEDADTP ADAPGKTGLN ITYAIPYQST NALSVRFNIS IYHRGAAHPS       120
     NAVKVLNFIK NQPVQLSDLF VPGSDYLQPI ADLAKKEITA KKISDENWIK EGTKPTQENY       180
     SIWHFTKKGI AIVFNTYQVA AYVYGEQTVD IPLSLISAMV KPEISKAVWG N                231
//

If you have problems or comments...

PBIL Back to PBIL home page