(data stored in ACNUC7421 zone)

EMBL: CP000675.YQIY

CP000675.YQIY        Location/Qualifiers
FT   CDS             581613..582260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiY"
FT                   /locus_tag="LPC_2854"
FT                   /product="amino acid (glutamine) ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2854"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56755"
FT                   /protein_id="ABQ56755.1"
FT                   /translation="MTEIVQNLFFIGKGIVLTMQLLTGGMLIGVLLGTLLSICRHQGVA
FT                   CFVINRFISILRGTPLILQLSFIYFAVPVLLGMRPSILVAGIVAFGLNSSAYFAEILRA
FT                   GIESLPKGQFEAALTLQIPTFYLWKDIILPQVIKNIFPAMINEMIALLKETALISTIGG
FT                   MDLMRQAQTLAAQQFTYFMPLCITGFYYYSLVLLLEALGKKIEKRGHYAASH"
     MTEIVQNLFF IGKGIVLTMQ LLTGGMLIGV LLGTLLSICR HQGVACFVIN RFISILRGTP        60
     LILQLSFIYF AVPVLLGMRP SILVAGIVAF GLNSSAYFAE ILRAGIESLP KGQFEAALTL       120
     QIPTFYLWKD IILPQVIKNI FPAMINEMIA LLKETALIST IGGMDLMRQA QTLAAQQFTY       180
     FMPLCITGFY YYSLVLLLEA LGKKIEKRGH YAASH                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page