(data stored in ACNUC7421 zone)

EMBL: CP000675.YUXH

CP000675.YUXH        Location/Qualifiers
FT   CDS             complement(139761..140363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yuxH"
FT                   /locus_tag="LPC_0133"
FT                   /product="hypothetical protein"
FT                   /note="similar to yuxH, E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54132"
FT                   /protein_id="ABQ54132.1"
FT                   /translation="MVVELDEPPVRTLLARQGIYDKNSAIFAYELLYRNSEAQNSQVDN
FT                   LNPLSGEAATSSVLLQLFANLDVNTIIGNKQAFINFTHNHLVQKIPMLLPKNRIVIEVL
FT                   ETVAIDQALLLNLMELKKQGYQIALDDFVFRNELAPLVDMADIIKIDVLHLDQQQIAEQ
FT                   LLPLKSFRGKLLAEKIEDKQQFNHCVNLGFDFFQGFF"
     MVVELDEPPV RTLLARQGIY DKNSAIFAYE LLYRNSEAQN SQVDNLNPLS GEAATSSVLL        60
     QLFANLDVNT IIGNKQAFIN FTHNHLVQKI PMLLPKNRIV IEVLETVAID QALLLNLMEL       120
     KKQGYQIALD DFVFRNELAP LVDMADIIKI DVLHLDQQQI AEQLLPLKSF RGKLLAEKIE       180
     DKQQFNHCVN LGFDFFQGFF                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page