(data stored in ACNUC7421 zone)

EMBL: CP000690.PE1

CP000690.PE1         Location/Qualifiers
FT   CDS             complement(42..3290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3292"
FT                   /product="error-prone DNA polymerase, DnaE-like"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP C-terminal domain protein; nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28905"
FT                   /db_xref="GOA:A5FTH3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH3"
FT                   /protein_id="ABQ28905.1"
FT                   /translation="MSTDTAYVELHCTSHFSFLRGASSCDELFAQAAHLGLEALAITDR
FT                   NTLAGIVRAHVAAKANDMRLIVGCRLDLTDGTALLVYPTDRPAYARLSRLLSLGKQRGG
FT                   KAQCRLDWSDLVAYAEGLIGVLVPGEADDACVRNLRRLAQSFGDRAYLALTLRRRPNDA
FT                   LRLFELSNLAARAKVPTVVTNDVLFHARDRRILQDVVTCIRHGCTIDDAGFRRERHADR
FT                   YLKPPAEMHRLFSRYPEALARTQEIADRCLFSLDELRYQYPDENVLPGLTTQEALTQLT
FT                   WEGAAQRYPAGVPAEVVTILRHELRLIETLDYAPYFLTVNSIVRFARSQGILCQGRGSA
FT                   ANSAVCFVLGITSIDPERNDLLFERFISEERREPPDIDVDFEHERREIVMQWVFDTYGR
FT                   DHAALCSTVIRYRTKGALRDVGKALGLPEDLITALNAQVWGWSEGGIEPKHAAELHLNL
FT                   EDRRLKLAIDLARELIGTPRHLSQHPGGFVLTRDRLDELVPIEPAAMDNRQIIEWDKDD
FT                   IDALKFMKVDCLALGMLSCMKRGFDLLAQHKGIELDLATIPAEDPHTYAMIRRADTLGT
FT                   FQIESRAQMVMLPRMKPRTFYDLVIEVAIVRPGPIQGDMVHPYLRRREGKEAVVYPKPE
FT                   LEKVLGKTLGVPLFQEQAMRVAIECAGFTATEADQLRRSMATFKFTGGVSHFRDKLVSG
FT                   MVANGYEQEFAERTFSQLEGFGSYGFPESHAASFALIAYASSWLKCHHPDVFCAALLNA
FT                   QPMGFYAPAQIVRDAKDHGVEIRPVCVNASRWDCTLEPTHDESRLAVRLGLRMVKGVAN
FT                   PHVAKMIAARANHLFASVDDLWRRAGVPTAALVQMAEADAFLPSLKLARRDALWAIKAL
FT                   RDEALPLFAAVANRTEQPVSELQEPVFALKPLTGGGEVVEDYVHLGLSLRSHPVAYLRE
FT                   DLRRERIVSCDQVMSTRDGKFLETAGIVLVRQRPGSARGVMFITIEDETGIANLVIWPN
FT                   LYEKQRLIILSSGMIAVYGQIQREGEVVHLIAHRLTDMSAALASIGRRENVFPMPRGHC
FT                   VGQDPRDTLGRAPGDIFVPDRHIDGIKVKSRDFR"
     MSTDTAYVEL HCTSHFSFLR GASSCDELFA QAAHLGLEAL AITDRNTLAG IVRAHVAAKA        60
     NDMRLIVGCR LDLTDGTALL VYPTDRPAYA RLSRLLSLGK QRGGKAQCRL DWSDLVAYAE       120
     GLIGVLVPGE ADDACVRNLR RLAQSFGDRA YLALTLRRRP NDALRLFELS NLAARAKVPT       180
     VVTNDVLFHA RDRRILQDVV TCIRHGCTID DAGFRRERHA DRYLKPPAEM HRLFSRYPEA       240
     LARTQEIADR CLFSLDELRY QYPDENVLPG LTTQEALTQL TWEGAAQRYP AGVPAEVVTI       300
     LRHELRLIET LDYAPYFLTV NSIVRFARSQ GILCQGRGSA ANSAVCFVLG ITSIDPERND       360
     LLFERFISEE RREPPDIDVD FEHERREIVM QWVFDTYGRD HAALCSTVIR YRTKGALRDV       420
     GKALGLPEDL ITALNAQVWG WSEGGIEPKH AAELHLNLED RRLKLAIDLA RELIGTPRHL       480
     SQHPGGFVLT RDRLDELVPI EPAAMDNRQI IEWDKDDIDA LKFMKVDCLA LGMLSCMKRG       540
     FDLLAQHKGI ELDLATIPAE DPHTYAMIRR ADTLGTFQIE SRAQMVMLPR MKPRTFYDLV       600
     IEVAIVRPGP IQGDMVHPYL RRREGKEAVV YPKPELEKVL GKTLGVPLFQ EQAMRVAIEC       660
     AGFTATEADQ LRRSMATFKF TGGVSHFRDK LVSGMVANGY EQEFAERTFS QLEGFGSYGF       720
     PESHAASFAL IAYASSWLKC HHPDVFCAAL LNAQPMGFYA PAQIVRDAKD HGVEIRPVCV       780
     NASRWDCTLE PTHDESRLAV RLGLRMVKGV ANPHVAKMIA ARANHLFASV DDLWRRAGVP       840
     TAALVQMAEA DAFLPSLKLA RRDALWAIKA LRDEALPLFA AVANRTEQPV SELQEPVFAL       900
     KPLTGGGEVV EDYVHLGLSL RSHPVAYLRE DLRRERIVSC DQVMSTRDGK FLETAGIVLV       960
     RQRPGSARGV MFITIEDETG IANLVIWPNL YEKQRLIILS SGMIAVYGQI QREGEVVHLI      1020
     AHRLTDMSAA LASIGRRENV FPMPRGHCVG QDPRDTLGRA PGDIFVPDRH IDGIKVKSRD      1080
     FR                                                                     1082
//

If you have problems or comments...

PBIL Back to PBIL home page