(data stored in ACNUC7421 zone)

EMBL: CP000690.PE10

CP000690.PE10        Location/Qualifiers
FT   CDS             13271..14263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28914"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI2"
FT                   /protein_id="ABQ28914.1"
FT                   /translation="MRVLRNYGLLDLRCAASGPHPRKEGPMSAGSFRAALVAFSTVIVP
FT                   AAAQAEPPATTVQYQVMVSAGLAARKPFEAWFVLDKSSDPRVPGYSIPAGATIRFVFPK
FT                   SFTPKPGGVLGAVMLKGWSQGAISTKFITALDPTNPRVVAIHFAAPIAPGSVENPGLKA
FT                   IHLRTNEINPTTAGSYPITIQFVDAGALSGKTTAIAHITKKPVPNIAAYNQLHPGKDED
FT                   WQHVRAGHAAHLPIDFLATLPNECRSSFSLKSTGDRTLNILSDGKPIGSISANGVPVVL
FT                   TPQPFGPGFARLGVVEVHAKAGSTAGMAEITAALNGGTHYTIHLIVEDR"
     MRVLRNYGLL DLRCAASGPH PRKEGPMSAG SFRAALVAFS TVIVPAAAQA EPPATTVQYQ        60
     VMVSAGLAAR KPFEAWFVLD KSSDPRVPGY SIPAGATIRF VFPKSFTPKP GGVLGAVMLK       120
     GWSQGAISTK FITALDPTNP RVVAIHFAAP IAPGSVENPG LKAIHLRTNE INPTTAGSYP       180
     ITIQFVDAGA LSGKTTAIAH ITKKPVPNIA AYNQLHPGKD EDWQHVRAGH AAHLPIDFLA       240
     TLPNECRSSF SLKSTGDRTL NILSDGKPIG SISANGVPVV LTPQPFGPGF ARLGVVEVHA       300
     KAGSTAGMAE ITAALNGGTH YTIHLIVEDR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page