(data stored in ACNUC7421 zone)

EMBL: CP000690.PE100

CP000690.PE100       Location/Qualifiers
FT   CDS             116044..116397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3397"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29004"
FT                   /db_xref="GOA:A5FTS2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS2"
FT                   /protein_id="ABQ29004.1"
FT                   /translation="MRIGDIARRSGLSASRIRFYERQGLIPVAARSENGYRDYPMSVLE
FT                   TLDMIRQAQSLGFTLDEIRAELVQGGGEPPVGKQILLALHEKLKVLEQHINQMTHRKQR
FT                   IVSLIEKYEASHS"
     MRIGDIARRS GLSASRIRFY ERQGLIPVAA RSENGYRDYP MSVLETLDMI RQAQSLGFTL        60
     DEIRAELVQG GGEPPVGKQI LLALHEKLKV LEQHINQMTH RKQRIVSLIE KYEASHS          117
//

If you have problems or comments...

PBIL Back to PBIL home page