(data stored in ACNUC7421 zone)

EMBL: CP000690.PE102

CP000690.PE102       Location/Qualifiers
FT   CDS             116928..118475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3399"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29006"
FT                   /db_xref="GOA:A5FTS4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS4"
FT                   /protein_id="ABQ29006.1"
FT                   /translation="MPVERIAMRDVREIVRLRMAGLSTRQVGIRVGVAASTVRLTLRRL
FT                   EAAGLDGPGALALSEAALERRLFEGSAGKRPGHRRVDEPDWGRIRRELQRKHVTLSILW
FT                   DEYIAEHPDGYRYSRFCELYRSWEARLPVTMRQTHASGEKLFVDYAGDTVPVVIDRLTG
FT                   ETRAAQIFVAVLGASSFTYAEATWTQTLPDWIEAHNRTLAAIGGVPALLVPDNARVAII
FT                   RACLYDPQVNRTYTDMARHYGTAILPARPRRPRDKAKVEVAVLLAERWLLGKLRNRAFY
FT                   SLAELNAAIAEFCRWLNEERVVRRLGATRRHLLETLDRPALKELPAEPYVLAQWRRRRV
FT                   GIDYHVEIEKHFYSVPYRHARAEVEARFTVRTVEIFLRGERIAVHARGSGNGKHTTIAE
FT                   HMPSSHRRYGDWTIARIHQEAARLGPSVATLCTLILERRPHPEQGFRACIGILRLARSV
FT                   GADRLDAAAERALTIGTLTYGSVKSILDHRLERAAGTASPDPTPIRHPNIRGGGYFH"
     MPVERIAMRD VREIVRLRMA GLSTRQVGIR VGVAASTVRL TLRRLEAAGL DGPGALALSE        60
     AALERRLFEG SAGKRPGHRR VDEPDWGRIR RELQRKHVTL SILWDEYIAE HPDGYRYSRF       120
     CELYRSWEAR LPVTMRQTHA SGEKLFVDYA GDTVPVVIDR LTGETRAAQI FVAVLGASSF       180
     TYAEATWTQT LPDWIEAHNR TLAAIGGVPA LLVPDNARVA IIRACLYDPQ VNRTYTDMAR       240
     HYGTAILPAR PRRPRDKAKV EVAVLLAERW LLGKLRNRAF YSLAELNAAI AEFCRWLNEE       300
     RVVRRLGATR RHLLETLDRP ALKELPAEPY VLAQWRRRRV GIDYHVEIEK HFYSVPYRHA       360
     RAEVEARFTV RTVEIFLRGE RIAVHARGSG NGKHTTIAEH MPSSHRRYGD WTIARIHQEA       420
     ARLGPSVATL CTLILERRPH PEQGFRACIG ILRLARSVGA DRLDAAAERA LTIGTLTYGS       480
     VKSILDHRLE RAAGTASPDP TPIRHPNIRG GGYFH                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page