(data stored in ACNUC7421 zone)

EMBL: CP000690.PE103

CP000690.PE103       Location/Qualifiers
FT   CDS             118493..119239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3400"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding N-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29007"
FT                   /db_xref="GOA:A5FTS5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS5"
FT                   /protein_id="ABQ29007.1"
FT                   /translation="MLNHPTLDQIHQLGLAGMARAFTELHANPETPSLSHAEWLGLLLD
FT                   REITVRRDKRLSTRLRHAKLRHDGAIEDVDYRSARGLDRALFQKLIQGEWIDAHDNLVL
FT                   SGPTGVGKSWLACALGHKACRDDRSVLYQRAPKLFTELALARAEGRHGRMIRTLGTVNL
FT                   LILDDFGLAPLDASARHDLLEIVEDRYGRRATIITSQIPPAHWHELIGDPTYADAILDR
FT                   LLHNAHRIELTGESLRKTRKQTPKTA"
     MLNHPTLDQI HQLGLAGMAR AFTELHANPE TPSLSHAEWL GLLLDREITV RRDKRLSTRL        60
     RHAKLRHDGA IEDVDYRSAR GLDRALFQKL IQGEWIDAHD NLVLSGPTGV GKSWLACALG       120
     HKACRDDRSV LYQRAPKLFT ELALARAEGR HGRMIRTLGT VNLLILDDFG LAPLDASARH       180
     DLLEIVEDRY GRRATIITSQ IPPAHWHELI GDPTYADAIL DRLLHNAHRI ELTGESLRKT       240
     RKQTPKTA                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page