(data stored in ACNUC7421 zone)

EMBL: CP000690.PE104

CP000690.PE104       Location/Qualifiers
FT   CDS             complement(120006..120416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3401"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29008"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS6"
FT                   /protein_id="ABQ29008.1"
FT                   /translation="MNFDTKVAILILNDLAVWQKLNVTAFLATGIAAAAPEAMGEPYED
FT                   ARGRQHARLLGQPIMIFAANTEVLQRAYGQAIERNVIRAVYVRAMFSTGHDAANRAVFK
FT                   AEPADVPDLVGLALRGLKKDVDKAVKGASLHA"
     MNFDTKVAIL ILNDLAVWQK LNVTAFLATG IAAAAPEAMG EPYEDARGRQ HARLLGQPIM        60
     IFAANTEVLQ RAYGQAIERN VIRAVYVRAM FSTGHDAANR AVFKAEPADV PDLVGLALRG       120
     LKKDVDKAVK GASLHA                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page