(data stored in ACNUC7421 zone)

EMBL: CP000690.PE105

CP000690.PE105       Location/Qualifiers
FT   CDS             complement(120451..121296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3402"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29009"
FT                   /db_xref="GOA:A5FTS7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS7"
FT                   /protein_id="ABQ29009.1"
FT                   /translation="MNSMSDRICLTHDTASGIEAVHARFMAHAYDLHRHDDWLVGVTES
FT                   GVQDFICRGARRRSTPGRVILIEPQEAHDGQAGDASGFAYSMIYLPRSWLRAGLMDAYG
FT                   GDPGFAASLCDDPLLAHSIRAACGVLFHSSERLIRDAALDAVLDRLRPHLGRPRRDAPG
FT                   GGAARVARLARELLHDTMARDIGANSLAKAAGAASRFQLARAFRAAYGTSPHSYLMQIR
FT                   LLRARQLLATGMRPATVAVECGFADQSHLGRRFRRAYGLTPAAYRALCTNVPDCKAKVG
FT                   "
     MNSMSDRICL THDTASGIEA VHARFMAHAY DLHRHDDWLV GVTESGVQDF ICRGARRRST        60
     PGRVILIEPQ EAHDGQAGDA SGFAYSMIYL PRSWLRAGLM DAYGGDPGFA ASLCDDPLLA       120
     HSIRAACGVL FHSSERLIRD AALDAVLDRL RPHLGRPRRD APGGGAARVA RLARELLHDT       180
     MARDIGANSL AKAAGAASRF QLARAFRAAY GTSPHSYLMQ IRLLRARQLL ATGMRPATVA       240
     VECGFADQSH LGRRFRRAYG LTPAAYRALC TNVPDCKAKV G                           281
//

If you have problems or comments...

PBIL Back to PBIL home page