(data stored in ACNUC7421 zone)

EMBL: CP000690.PE106

CP000690.PE106       Location/Qualifiers
FT   CDS             complement(121975..122688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3403"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29010"
FT                   /db_xref="GOA:A5FTS8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS8"
FT                   /protein_id="ABQ29010.1"
FT                   /translation="MTQRKALKIIPQPMRRQVEDGLRKAIIAGVFPAGAHLSDRLLCET
FT                   FGASRSIVREAVRLLEAEGLVVVHPNRGPFVASISATEAEEIYELRAALEGLAGEGFAR
FT                   RATTGERAALRHIYEELAASGPATSRETLLDIKRRFYDVLTAGCRNAYVSRILGQLLNR
FT                   NSQLRATSLSAPGRLPHTVAELGRIVDAIDRRDAAAAGAACRDHVHRAAEAALRIIGER
FT                   EATCVASSFATAEGI"
     MTQRKALKII PQPMRRQVED GLRKAIIAGV FPAGAHLSDR LLCETFGASR SIVREAVRLL        60
     EAEGLVVVHP NRGPFVASIS ATEAEEIYEL RAALEGLAGE GFARRATTGE RAALRHIYEE       120
     LAASGPATSR ETLLDIKRRF YDVLTAGCRN AYVSRILGQL LNRNSQLRAT SLSAPGRLPH       180
     TVAELGRIVD AIDRRDAAAA GAACRDHVHR AAEAALRIIG EREATCVASS FATAEGI          237
//

If you have problems or comments...

PBIL Back to PBIL home page