(data stored in ACNUC7421 zone)

EMBL: CP000690.PE109

CP000690.PE109       Location/Qualifiers
FT   CDS             124229..125566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3406"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29013"
FT                   /db_xref="GOA:A5FTT1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT1"
FT                   /protein_id="ABQ29013.1"
FT                   /translation="MASYADTARPDALAVPIEERRRAAIRGAFFSEYIDMFDIYVPIVV
FT                   LTPVLFFFQPAHLPPGEEALLASLVFITTLLGRPIGAFLFGLVADRIGRRMASIYSVSG
FT                   FGLITLLIAALPGYQSIGVASYWLLVLLRFLDGICLGGGYTGAMPLAMEYSRKSERGFA
FT                   GGLILAAFPAAYVTINLVAMAVFALVPLHGLDSPYAQWGWRIPFVIGAALAGMLVLYYV
FT                   FKVSESEIWITETAEGTQKLPLTDLIAGRSGRNLLQVLLLMTGFWLTQNLITIFIPATL
FT                   LFHFLHLSKFQLTSTLLISYALLFFSYIGSGMLGQKVGRRRFFVVAGPLIATVGAAIMY
FT                   VLVGVPGLSLPMIIVLVCVLSILVTSPWGVIVTYINERFATDVRATGFGVGFSLSVIIP
FT                   SFYAFYMSWLGYLMPFRYTPVVLLVIGGLIGMVGALLGPETRDVDF"
     MASYADTARP DALAVPIEER RRAAIRGAFF SEYIDMFDIY VPIVVLTPVL FFFQPAHLPP        60
     GEEALLASLV FITTLLGRPI GAFLFGLVAD RIGRRMASIY SVSGFGLITL LIAALPGYQS       120
     IGVASYWLLV LLRFLDGICL GGGYTGAMPL AMEYSRKSER GFAGGLILAA FPAAYVTINL       180
     VAMAVFALVP LHGLDSPYAQ WGWRIPFVIG AALAGMLVLY YVFKVSESEI WITETAEGTQ       240
     KLPLTDLIAG RSGRNLLQVL LLMTGFWLTQ NLITIFIPAT LLFHFLHLSK FQLTSTLLIS       300
     YALLFFSYIG SGMLGQKVGR RRFFVVAGPL IATVGAAIMY VLVGVPGLSL PMIIVLVCVL       360
     SILVTSPWGV IVTYINERFA TDVRATGFGV GFSLSVIIPS FYAFYMSWLG YLMPFRYTPV       420
     VLLVIGGLIG MVGALLGPET RDVDF                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page