(data stored in ACNUC7421 zone)

EMBL: CP000690.PE11

CP000690.PE11        Location/Qualifiers
FT   CDS             14557..15813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3303"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28915"
FT                   /db_xref="GOA:A5FTI3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI3"
FT                   /protein_id="ABQ28915.1"
FT                   /translation="MNTLPPRSPETRPDNSPLSSGVEKQQASRPPSRWRRVVGGAIVIL
FT                   VIAAGAGWLWRGYSRAFTVQVAPIREHVVEQVFGLGAIGADVQSALGFQVAGVISRIDA
FT                   NEGNVVKAGQVLAQLDARDVAAQLALAKAGVQQARAAIDKADADISNASANLANATAIA
FT                   TRREALSRNGFASAEEAQNYITAERVAEGNLQVAKVEAETARAGLAEALAQEAFEVATL
FT                   GNYTLRAPYDGWVVARNLNLGASVAPGQAVFTVVDPRTIWVVGYVDERLAGRLHVGQKA
FT                   EIVLRSEAGRRFPGHVARIEIQSNATNEERLVDVAFDKLPSDIHLAEQAEIYVTTGVLA
FT                   RAALVPQSVVTGLADGKGTVWTVQDGRLRQHQVSFGPELLDGDLPVVAGLAQNAKVVTG
FT                   PAIGLRAGRAAKVAKGPAS"
     MNTLPPRSPE TRPDNSPLSS GVEKQQASRP PSRWRRVVGG AIVILVIAAG AGWLWRGYSR        60
     AFTVQVAPIR EHVVEQVFGL GAIGADVQSA LGFQVAGVIS RIDANEGNVV KAGQVLAQLD       120
     ARDVAAQLAL AKAGVQQARA AIDKADADIS NASANLANAT AIATRREALS RNGFASAEEA       180
     QNYITAERVA EGNLQVAKVE AETARAGLAE ALAQEAFEVA TLGNYTLRAP YDGWVVARNL       240
     NLGASVAPGQ AVFTVVDPRT IWVVGYVDER LAGRLHVGQK AEIVLRSEAG RRFPGHVARI       300
     EIQSNATNEE RLVDVAFDKL PSDIHLAEQA EIYVTTGVLA RAALVPQSVV TGLADGKGTV       360
     WTVQDGRLRQ HQVSFGPELL DGDLPVVAGL AQNAKVVTGP AIGLRAGRAA KVAKGPAS         418
//

If you have problems or comments...

PBIL Back to PBIL home page