(data stored in ACNUC7421 zone)

EMBL: CP000690.PE110

CP000690.PE110       Location/Qualifiers
FT   CDS             125577..126365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3407"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29014"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT2"
FT                   /protein_id="ABQ29014.1"
FT                   /translation="MNQPEILAVRYGTRKTEKSEIYYDYARYGEADGEAVMDYYFWILR
FT                   DGTETIVIDTGFSAASGAARKRDTTIAPAAALARLGIDPASVRDVILTHAHYDHTGNLD
FT                   LFPNALITMSRTEYAFISGPFADRVPLAVAMDSDDNRGIVRLHEAGRIKLVGPRHEFRP
FT                   GVELIELPGHSPGQMSLVIARPDGPVILSSDAVHYYEELEKDRPFTVMSGLLDMYRSLD
FT                   AIRVMRETPGAVLVPGHDPEVMRRFTLVDPADPGFAVRIG"
     MNQPEILAVR YGTRKTEKSE IYYDYARYGE ADGEAVMDYY FWILRDGTET IVIDTGFSAA        60
     SGAARKRDTT IAPAAALARL GIDPASVRDV ILTHAHYDHT GNLDLFPNAL ITMSRTEYAF       120
     ISGPFADRVP LAVAMDSDDN RGIVRLHEAG RIKLVGPRHE FRPGVELIEL PGHSPGQMSL       180
     VIARPDGPVI LSSDAVHYYE ELEKDRPFTV MSGLLDMYRS LDAIRVMRET PGAVLVPGHD       240
     PEVMRRFTLV DPADPGFAVR IG                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page