(data stored in ACNUC7421 zone)

EMBL: CP000690.PE113

CP000690.PE113       Location/Qualifiers
FT   CDS             128144..128524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3410"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29017"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT5"
FT                   /protein_id="ABQ29017.1"
FT                   /translation="MKIIEGRAAGAPSQARSDSFTGTVWADPVLSMPGELSINTVFFSP
FT                   GARTFWHMHERGQILNVLAGRGLVCTEGGRPQPIRAGDTVWIPAGERHWHGAAPDSYMI
FT                   HTATSLGRTDWQGPVAERDYAP"
     MKIIEGRAAG APSQARSDSF TGTVWADPVL SMPGELSINT VFFSPGARTF WHMHERGQIL        60
     NVLAGRGLVC TEGGRPQPIR AGDTVWIPAG ERHWHGAAPD SYMIHTATSL GRTDWQGPVA       120
     ERDYAP                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page