(data stored in ACNUC7421 zone)

EMBL: CP000690.PE115

CP000690.PE115       Location/Qualifiers
FT   CDS             129513..129839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3412"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29019"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT7"
FT                   /protein_id="ABQ29019.1"
FT                   /translation="MIHELRIYHCMPGRLPDLLKRFETVTLGLWDKHGIRQAGFWTTLV
FT                   GESNMDLTYLLAWETLAERESKWTAFQADPEWLAKRAETEKNGQIVASITNQILVPTAF
FT                   SAVR"
     MIHELRIYHC MPGRLPDLLK RFETVTLGLW DKHGIRQAGF WTTLVGESNM DLTYLLAWET        60
     LAERESKWTA FQADPEWLAK RAETEKNGQI VASITNQILV PTAFSAVR                    108
//

If you have problems or comments...

PBIL Back to PBIL home page