(data stored in ACNUC7421 zone)

EMBL: CP000690.PE116

CP000690.PE116       Location/Qualifiers
FT   CDS             complement(130005..130247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29020"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT8"
FT                   /protein_id="ABQ29020.1"
FT                   /translation="MPPTTVLAYGHPKGGTPSMLAAPLVALDLPLRVLVRVRDDGQTVI
FT                   AFHPIGAMLRRSGVPNALADKLDAAQQILLKAVSP"
     MPPTTVLAYG HPKGGTPSML AAPLVALDLP LRVLVRVRDD GQTVIAFHPI GAMLRRSGVP        60
     NALADKLDAA QQILLKAVSP                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page