(data stored in ACNUC7421 zone)

EMBL: CP000690.PE117

CP000690.PE117       Location/Qualifiers
FT   CDS             130412..130687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3414"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29021"
FT                   /db_xref="GOA:A5FTT9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT9"
FT                   /protein_id="ABQ29021.1"
FT                   /translation="MARNHKPEEIIGKLREAEIVLAQGGTVADACRRIGVTEQSYYRWR
FT                   KEYGGLKLDQARRMKELERENARLKRLVADLSLDKAILTEATRGNF"
     MARNHKPEEI IGKLREAEIV LAQGGTVADA CRRIGVTEQS YYRWRKEYGG LKLDQARRMK        60
     ELERENARLK RLVADLSLDK AILTEATRGN F                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page