(data stored in ACNUC7421 zone)

EMBL: CP000690.PE118

CP000690.PE118       Location/Qualifiers
FT   CDS             130732..131580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3415"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29022"
FT                   /db_xref="GOA:A5FTU0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU0"
FT                   /protein_id="ABQ29022.1"
FT                   /translation="MSVSERRVCRVLGQHRSTQRKVPRGADDEAALTGDIIALARQYGR
FT                   YGYRRVTALLRDAGWHVNRKRVERIWRREGLKVPQRQPKRSRLWLNDGSCIRLRPEYPG
FT                   HVWSYDFVEGRTHDGRKFRILSVIDEASRECLALPVARRLRSEDVLGALAELFVTRGPP
FT                   AHIRSDNGPEFIARAVRQWLGKVGVKTLYITPGSPWENGYCESFNGSLRDELLNGEIFY
FT                   TLAEAKILIETWRRHYNTVRPHNSLGYRPPAPETATPPRPPSGSASLHRQPAMAAETTM
FT                   H"
     MSVSERRVCR VLGQHRSTQR KVPRGADDEA ALTGDIIALA RQYGRYGYRR VTALLRDAGW        60
     HVNRKRVERI WRREGLKVPQ RQPKRSRLWL NDGSCIRLRP EYPGHVWSYD FVEGRTHDGR       120
     KFRILSVIDE ASRECLALPV ARRLRSEDVL GALAELFVTR GPPAHIRSDN GPEFIARAVR       180
     QWLGKVGVKT LYITPGSPWE NGYCESFNGS LRDELLNGEI FYTLAEAKIL IETWRRHYNT       240
     VRPHNSLGYR PPAPETATPP RPPSGSASLH RQPAMAAETT MH                          282
//

If you have problems or comments...

PBIL Back to PBIL home page