(data stored in ACNUC7421 zone)

EMBL: CP000690.PE119

CP000690.PE119       Location/Qualifiers
FT   CDS             complement(131823..132533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3416"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29023"
FT                   /db_xref="GOA:A5FTU1"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU1"
FT                   /protein_id="ABQ29023.1"
FT                   /translation="MRLTETKIAKVLAAHRIRRVTAHDALAILRRPALTVAPGTADAAR
FT                   VHITAVAERLNLVNRQIKTVLQRIDGLVEQLAGPETEPGQDTEQRDAAILRSLPGVGRI
FT                   VLATLLAEAHQALQARDYQALRTLTGVAPVTKRSGRSCRVEMRQACSGRLRTVVYHWAR
FT                   VATQQTPAVAAATPPSEDVATLTAAPSEPLPIACWALHASCSPTDPCSIPRRCPPIAQN
FT                   QLDHWWEVPPHSRL"
     MRLTETKIAK VLAAHRIRRV TAHDALAILR RPALTVAPGT ADAARVHITA VAERLNLVNR        60
     QIKTVLQRID GLVEQLAGPE TEPGQDTEQR DAAILRSLPG VGRIVLATLL AEAHQALQAR       120
     DYQALRTLTG VAPVTKRSGR SCRVEMRQAC SGRLRTVVYH WARVATQQTP AVAAATPPSE       180
     DVATLTAAPS EPLPIACWAL HASCSPTDPC SIPRRCPPIA QNQLDHWWEV PPHSRL           236
//

If you have problems or comments...

PBIL Back to PBIL home page