(data stored in ACNUC7421 zone)

EMBL: CP000690.PE12

CP000690.PE12        Location/Qualifiers
FT   CDS             15810..16952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3304"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28916"
FT                   /db_xref="GOA:A5FTI4"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI4"
FT                   /protein_id="ABQ28916.1"
FT                   /translation="MNLALRDVRRNKLRFALTILGVGMLIGVVIAMAGIYEGAVTDALS
FT                   MPRALKADLWVVQPRTFGPFAEPSRIPRDARELVRRIPGVAAAGAVTYQTVQTMADGKP
FT                   VRLLLEGYEIGRPGGPMKLTAGHGLTESHYQLVVDGSSGLKLGQAVRLGPFHDPYTVVG
FT                   LTHGMVGSGGDPVGWVTLLDAQALQFGVPPALERREAASGRKPPTTTDINAVLVRLAPG
FT                   AAAPIVARDIARWKHLAAVPETEEERYLTAFVIEKMQRQLGMFMAILVTVTAVIITLII
FT                   YTLTMDKLRAIATLKFIGAPDRVIVGMIVQQALVLGIGGFVIGLALVEEIKGTFPRRVQ
FT                   IEPRDLLIILVIVTIVCLAGSVLGVRAAVKINAAEALANG"
     MNLALRDVRR NKLRFALTIL GVGMLIGVVI AMAGIYEGAV TDALSMPRAL KADLWVVQPR        60
     TFGPFAEPSR IPRDARELVR RIPGVAAAGA VTYQTVQTMA DGKPVRLLLE GYEIGRPGGP       120
     MKLTAGHGLT ESHYQLVVDG SSGLKLGQAV RLGPFHDPYT VVGLTHGMVG SGGDPVGWVT       180
     LLDAQALQFG VPPALERREA ASGRKPPTTT DINAVLVRLA PGAAAPIVAR DIARWKHLAA       240
     VPETEEERYL TAFVIEKMQR QLGMFMAILV TVTAVIITLI IYTLTMDKLR AIATLKFIGA       300
     PDRVIVGMIV QQALVLGIGG FVIGLALVEE IKGTFPRRVQ IEPRDLLIIL VIVTIVCLAG       360
     SVLGVRAAVK INAAEALANG                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page