(data stored in ACNUC7421 zone)

EMBL: CP000690.PE120

CP000690.PE120       Location/Qualifiers
FT   CDS             complement(132767..133174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29024"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU2"
FT                   /protein_id="ABQ29024.1"
FT                   /translation="MKLPQSQVPICYLASGCRAGVPHGHWKATTFTGALRLSGMTAPFV
FT                   YDGPMNGAVFRAYVEQMLVPTLTPGDLVIMDNLPAHKAAGVRNSIEQAGATLLFLPPYS
FT                   PDFNPCMDGSCRSRCRIGFGERVGCGHVCGV"
     MKLPQSQVPI CYLASGCRAG VPHGHWKATT FTGALRLSGM TAPFVYDGPM NGAVFRAYVE        60
     QMLVPTLTPG DLVIMDNLPA HKAAGVRNSI EQAGATLLFL PPYSPDFNPC MDGSCRSRCR       120
     IGFGERVGCG HVCGV                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page