(data stored in ACNUC7421 zone)

EMBL: CP000690.PE124

CP000690.PE124       Location/Qualifiers
FT   CDS             complement(136476..137726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3421"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29028"
FT                   /db_xref="GOA:A5FTU6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU6"
FT                   /protein_id="ABQ29028.1"
FT                   /translation="MTNGKAANATGPLAGLRVLDLSHVMAGPVCGMMLADMGAEVIKVE
FT                   KVPGGDDTRRAVPPSVAGESAAFMMMNRNKRGIALNLKSPLGRDALLRLIDSSDILIEN
FT                   YRKGALDRMGFGYEAMHARNRGLIYCSISGFGRTGPYAERGGFDLIAQGMSGVMSVTGE
FT                   GPGRAPVKVGPPIADIGAGMLAAMGILAALNYRNQTGEGQMVDTSLLEAGITYLYWHAA
FT                   ISFATGSSPGPLGSGHPLMAPYQAFRTSDDPITVGAANEGNWRRLLAVLQADDLAADPR
FT                   FTTNAGRMENLSELEARLEAIFRQKTSAEWLVALDKAGVPAGPVLTVQQMAEDPQVKAR
FT                   SMIVETEHAVAGRTRALGLPVKFSTTPANVRRPAPAYGQHTREVLREAGFSEVEIDGMI
FT                   DSGAAQAAMPERKEAAE"
     MTNGKAANAT GPLAGLRVLD LSHVMAGPVC GMMLADMGAE VIKVEKVPGG DDTRRAVPPS        60
     VAGESAAFMM MNRNKRGIAL NLKSPLGRDA LLRLIDSSDI LIENYRKGAL DRMGFGYEAM       120
     HARNRGLIYC SISGFGRTGP YAERGGFDLI AQGMSGVMSV TGEGPGRAPV KVGPPIADIG       180
     AGMLAAMGIL AALNYRNQTG EGQMVDTSLL EAGITYLYWH AAISFATGSS PGPLGSGHPL       240
     MAPYQAFRTS DDPITVGAAN EGNWRRLLAV LQADDLAADP RFTTNAGRME NLSELEARLE       300
     AIFRQKTSAE WLVALDKAGV PAGPVLTVQQ MAEDPQVKAR SMIVETEHAV AGRTRALGLP       360
     VKFSTTPANV RRPAPAYGQH TREVLREAGF SEVEIDGMID SGAAQAAMPE RKEAAE           416
//

If you have problems or comments...

PBIL Back to PBIL home page