(data stored in ACNUC7421 zone)

EMBL: CP000690.PE125

CP000690.PE125       Location/Qualifiers
FT   CDS             137854..138498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3422"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29029"
FT                   /db_xref="GOA:A5FTU7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU7"
FT                   /protein_id="ABQ29029.1"
FT                   /translation="MRTMVHEDVVTFIRERLIEGEIAPGARIPERDLCAALNVSRTPLR
FT                   EALKVLAAEGYVVLLPNRGARAAKLTVQDVRDLFQLSAALESAGGELACQRITDREIAT
FT                   IAEQHATMASYFARGDMQAYYACNRAIHEAIMAASGNAAMINVYESVSARIRRARYIAP
FT                   MTEAHWREAFLEHEAMLNALTRRDGPMLAMILKTHLRHKAQEVERAGFAAD"
     MRTMVHEDVV TFIRERLIEG EIAPGARIPE RDLCAALNVS RTPLREALKV LAAEGYVVLL        60
     PNRGARAAKL TVQDVRDLFQ LSAALESAGG ELACQRITDR EIATIAEQHA TMASYFARGD       120
     MQAYYACNRA IHEAIMAASG NAAMINVYES VSARIRRARY IAPMTEAHWR EAFLEHEAML       180
     NALTRRDGPM LAMILKTHLR HKAQEVERAG FAAD                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page